KEGG   Caenorhabditis briggsae: CBG00954Help
Entry
CBG00954          CDS       T01054                                 

Gene name
Cbr-ugt-58
Definition
C. briggsae CBR-UGT-58 protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBG00954 (Cbr-ugt-58)
   00053 Ascorbate and aldarate metabolism
    CBG00954 (Cbr-ugt-58)
   00500 Starch and sucrose metabolism
    CBG00954 (Cbr-ugt-58)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG00954 (Cbr-ugt-58)
   00860 Porphyrin and chlorophyll metabolism
    CBG00954 (Cbr-ugt-58)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG00954 (Cbr-ugt-58)
   00982 Drug metabolism - cytochrome P450
    CBG00954 (Cbr-ugt-58)
   00983 Drug metabolism - other enzymes
    CBG00954 (Cbr-ugt-58)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CBG00954 (Cbr-ugt-58)
Glycosyltransferases [BR:cbr01003]
 Others
  Hydrophobic molecule
   CBG00954 (Cbr-ugt-58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 535 aa AA seqDB search
LKCWLLLSIIGWVTAGDVLFIPSTLYPVHGQTMAVLAKELVDRGHQVTWLEIGTKQSDLV
LPSEVTREFWPAQFGDSTLQDIYQYRNHSSHSQLWNPEHLNENEQTTGWLASIRLCDSVL
TRSRSKFDRLVEKKFSTVIVDDLYNPCGVLIAGLKKSVYIYWSITGLRTESAWANQSPSP
PSYLPVAGTGLTDDLTFSERVYNVASYLKQLYLHQHIVQPRVDAVFQKHYPGVSTMFDIE
RNASINFVNTPPIFDFSRPYMPRVNFVGAIQCRKAKELPKEFATKISEHPEGFVVLSTGF
SAQWTKSPESTRQAYLKAFKSFPKLLFIWQFNGKLPEGSKAPSNLITKPWLQLQDLLGHE
QCRCHVSHGGLNSVIESVYHGVPVVGVPLTARGYDNLLRITARDSGVMIEKSEFNGDTLT
AAIREVTKNEKYKKEMLIFQDMVIDVPYTELYHAAFWVEFIERHQEVPHARSGADHLNFL
QYFLVDVIAFFFFVIFCTLSVIFYAIHTVIRTIGSVINGIRGVPRVKVSKGKKTN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
ctcaaatgctggctccttctatccataatcggttgggtaacagccggagatgtacttttc
attcctagtactttatatccagtacacggtcaaacaatggcagttttggccaaagaactc
gtcgatcggggtcatcaggtgacgtggctggagattggaacaaaacagtctgacctagtt
ctcccatcggaagtgacccgagagttttggcctgctcaattcggagattccactcttcaa
gacatttatcagtaccgcaatcactcgtctcattctcagctctggaatccagaacacctc
aacgaaaatgagcaaaccaccggatggttggcatcgattcgtctctgtgattcggttctg
acaagaagccgatcgaaatttgatcgacttgttgaaaaaaaattttccactgtcatcgtc
gacgacttgtacaacccatgtggtgtgctcatagctggactcaaaaagtccgtctacatc
tactggtcgattaccgggcttcgaaccgaatccgcgtgggccaatcagtccccatcacca
cccagctaccttccggtcgctggaaccggtctaactgatgatctcactttttctgagaga
gtctacaacgtggcatcctatttaaagcagttgtatctccatcagcatattgtgcagcca
agggttgatgctgtttttcagaagcactacccaggagtctccacgatgttcgatatcgag
cgaaacgcctcaatcaacttcgtcaacaccccgcccattttcgacttttcaagaccctac
atgccacgtgtcaactttgtaggagcaatccaatgtagaaaggcaaaggagctcccaaaa
gaatttgcgacgaaaatctccgaacatcccgaagggttcgtcgtcctctccacgggattc
tcagctcaatggacaaagtctccagaatccacgcgtcaagcatatctaaaagccttcaaa
tctttcccgaagcttctttttatttggcagttcaacggaaagcttccagaaggttctaaa
gctccctcaaatctcatcacaaagccatggcttcaacttcaagaccttctgggtcatgag
caatgccgatgccacgtgtcacatggtggattgaatagtgtgattgagtcggtgtatcat
ggggtgccggtcgttggagtaccactgacagcgagaggttatgataatttgttgaggatc
acggcgagagatagtggagtgatgattgagaagtcagagtttaatggggacacactgacg
gctgcgattcgcgaagtgacgaagaatgagaaatacaaaaaagagatgctcatcttccaa
gacatggtcatcgatgtcccatacaccgaactctaccacgccgccttctgggtggaattc
atcgaacgtcaccaagaagttccccatgcgagaagcggtgccgaccatctgaatttccta
cagtacttcctggtcgacgttatcgccttcttcttcttcgtcattttctgcacattatcc
gtgattttctacgcaattcataccgtaatccgaacgattggttcggtgatcaatggaatt
cgaggtgtgccgagagtgaaagtttcaaagggaaaaaagacaaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system