KEGG   Caenorhabditis briggsae: CBG00984Help
Entry
CBG00984          CDS       T01054                                 

Gene name
Cbr-usp-14
Definition
C. briggsae CBR-USP-14 protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CBG00984 (Cbr-usp-14)
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG00984 (Cbr-usp-14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 489 aa AA seqDB search
MPIVNVKWQKEKYVVEIDTSAPPMVFKAQLFALTQVLPERQKVVILGRTLGDDDWEGITL
KENMTIMMMGSIGEIPKAPTILEAQQQNVGQQAEEMSNLYPCGLANLGNTCYFNSCMQML
KEVNELILKPADETKIREQNDRLCHNLATLLCQLRDKDKALRSKGDPIKPFASIISLSES
YPQFEKFKQQDANECFVAIMTNLTRFYGLAGYPIDNLFKIKTETNCKCLETEEVAEKKTE
SATQLTCYVNQDVRFLQTGIKAGFEQEVERNSAQLGRDAKWQNHTLISRLPKYLTVNINR
FFFKESSKTNAKILKSVQFPISLDAYDLCTQELKDKLVTRRADIKLEEDAKLERELRKKV
LDKEQADKIFDDGVALPTEFESDPGSNNSGFYELKGIITHKGRSSQDGHYVAWLRSAEDN
KWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLYEARVIKQYPELPPAPVISEADNVVD
EPMEVSSKP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccaattgtaaatgtcaagtggcagaaagagaagtatgtggtggaaatcgacacctct
gcgccaccaatggtcttcaaagctcaacttttcgcactgactcaagtgcttccagaacga
cagaaggttgtgatccttggcagaaccttgggtgatgacgattgggaagggatcactttg
aaggagaatatgacgattatgatgatgggatccatcggagaaatcccaaaagcaccaaca
attctcgaagcccagcaacagaatgtcggccaacaagccgaggaaatgtccaacctctac
ccatgcggacttgccaatcttggaaacacttgctatttcaactcttgtatgcaaatgcta
aaggaggtcaacgagttgattttgaagccagccgacgaaaccaaaatccgtgagcaaaat
gatcgactctgccacaatttggccactttgctctgccagcttcgtgataaagataaggct
cttcgaagcaagggagacccaatcaaaccatttgcttcaattattagtctctcggagtcc
tatcctcaattcgaaaaattcaagcaacaagacgccaatgagtgttttgtcgcaatcatg
accaacctcactcggttctacggcctggctggatatccaattgataatcttttcaaaatt
aaaacagaaacgaattgtaaatgtctggaaactgaagaagtcgctgagaagaagaccgaa
agtgctactcaactgacttgctatgtgaatcaagacgttcgattcttgcaaaccggtatc
aaggcaggatttgagcaagaggtagagcgaaacagtgctcaattgggacgtgacgccaaa
tggcagaaccacactctgatctcccgtcttccaaagtatctgacagtcaatatcaacaga
ttcttcttcaaagaatcctccaaaacaaacgctaagattttgaagtcggtgcaattccca
atttctcttgacgcctacgatttgtgcactcaagagttgaaggacaagctcgtgactcga
cgtgctgatatcaaattggaagaggatgccaagttggaaagagagctgagaaagaaggtt
ctggataaggagcaagccgataaaatcttcgacgatggagtcgctcttccaaccgaattc
gagtctgatccaggatctaataactctggattctatgagctcaagggaatcatcactcac
aaaggacgctcctcgcaagacggtcactacgtggcatggctccgttctgccgaagacaac
aaatggcgtctgttcgacgatgagcacgtcaccgttgtcgacgaggaagcgattctgaag
acttctggaggaggtgactggcacagtgcctacgttcttctttacgaggcccgtgtcatc
aaacaatacccagaactgccaccagcaccggttatctccgaagctgataatgtcgttgat
gagccaatggaagtttcttctaagccataa

DBGET integrated database retrieval system