KEGG   Caenorhabditis briggsae: CBG01027Help
Entry
CBG01027          CDS       T01054                                 

Gene name
Cbr-cyp-13A6
Definition
C. briggsae CBR-CYP-13A6 protein
Orthology
K17861  
cytochrome P450, family 13
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 518 aa AA seqDB search
MILVLISAILLGVFTYSVWIWSYFIRKGIKGPRGFPGIGMLLQTLDHENPPFLKYRQWTK
QYGPVWGFTEGPQQTMVISEPEMVNEIFNKQFDNFYGRKLRPIIGDPEKDKRVNMFAAQG
KRWKRLRTMSSPSFSNNSLRKVKSTVQECGSEILWNIERKVATGEEIDMLLFYQEYTLGV
ISRIALGQSESKMFQNPLLLKVKSIFNGSWHLFLLTGLFPPLASVIRKMSKSLPADFVPA
FKIFDLIETAVEARMAQRESDIKNGIEPGEPQDFIDLFLDARTDADFLGEKNEDFSKTAV
MKVNKELTFDEIVGQCFVFLAAGFDTTALSLSYATFLLATHPDVQKRLQEEVDNECPDPE
ISFDQLSKLKYMECVMKEALRLYPLGVTANTRKCMRETVIDGVIFEEGMNIQVDTWTLHH
NKSIWGDDVEDFKPERWENSACEHLEHNGSYIPFGSGPRQCIGMRLAQIEQKIILAQILK
EYSFRTCKNTQIPLKLVGKLTLSPENVIVKLEPRKDLL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtactaatttccgctattttactaggtgttttcacctattctgtatggatc
tggtcatattttattcgaaaaggaatcaaagggccacgtggattccctggtattgggatg
ctgctgcagactctcgaccatgagaatccaccgtttttaaaatacaggcagtggacaaag
caatacgggcctgtttggggattcacagaaggtcctcaacaaacaatggtgatttctgag
cccgaaatggttaatgaaatattcaacaaacagttcgataacttttatggaagaaaactc
cgtccaatcattggtgatccagaaaaagacaaaagagtgaacatgtttgcagcacaggga
aaacggtggaaacgtttgagaacgatgtcaagtccttctttctctaacaacagtttgaga
aaagttaaaagtactgtacaagagtgtggatcggaaatattgtggaacatcgaaagaaaa
gtagcaactggcgaagagattgatatgcttttattctaccaggaatacacacttggagtt
atcagtcgtattgctctgggacaatctgaatccaaaatgttccaaaatccattactactg
aaagtcaaatctattttcaacggttcctggcacttattccttctcaccggacttttcccg
ccacttgcctccgttatccgaaaaatgtcgaaatctctacctgctgattttgtgccagct
tttaaaatatttgaccttattgagactgctgtagaagcacgaatggcccagcgggaaagt
gatatcaagaatggaatcgaaccaggagagcctcaagatttcattgacttatttttggat
gccagaactgatgctgacttcctgggagagaaaaacgaggacttctcgaaaacggcagtg
atgaaagttaacaaagaactgacttttgatgaaatcgtaggacaatgctttgtatttctg
gctgctggatttgatactaccgcattgtctctttcatacgccacgtttctattagcaacg
catcccgatgtacaaaaaaggcttcaagaagaagtggataacgaatgcccggatcctgaa
attagttttgatcaactatcaaaactaaaatatatggagtgtgtgatgaaagaagcattg
aggttgtatccattgggtgtgacagccaacacaaggaaatgtatgcgtgagacagtaatc
gatggcgttatatttgaagagggaatgaatattcaagttgatacgtggacacttcatcat
aacaaaagcatttggggagatgatgtcgaagacttcaagcctgaaagatgggaaaactct
gcctgcgaacacctggaacacaatggatcctacattccatttggttcagggccacggcaa
tgtattggaatgcggcttgctcaaattgaacagaaaattattctggctcaaattcttaaa
gaatactcgttcagaacatgcaaaaatacacagattccattgaaacttgtcggtaaatta
acgctatctcctgaaaatgtcatagttaaattggaacctagaaaggatctcttgtaa

DBGET integrated database retrieval system