KEGG   Caenorhabditis briggsae: CBG01119Help
Entry
CBG01119          CDS       T01054                                 

Definition
Hypothetical protein CBG01119
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG01119
   00052 Galactose metabolism
    CBG01119
Enzymes [BR:cbr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CBG01119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 330 aa AA seqDB search
MASGFIEITNKQGLSATLLPFGATLAKLTFPDKEGKNQDLVLGFNTIDEFESDTQSLGKT
VGRVANRIKNSQLKFDGKEYKMTPNNGPHYLHGGPNGLGYRKWELVRHAPQSVSFSVKAN
EQEDGLPGDAKIDVTYTVNDRNQLIIEHHATCEIPGLLALTNHAYWNLDGSEDVKEHFLE
MDSEEYVEVDDTFCPTGAIRCVKGTRFDFRNRKQLKAFGESENEILDLDNDLVIARKDPP
ITPTSNLRFWSQKSGIELSITTSYPVIHLYASKFLDCSGKNGEHYGANKALAIEPQFHSA
APNFENFPDVSLRPGQDYCQEIVYTFSHVN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggattcattgaaatcaccaataaacaaggattatcagctacactattaccg
tttggtgccacattggcaaaactgacatttccagataaagaaggaaaaaatcaggacttg
gtccttggatttaacactattgatgaattcgaatctgacactcaatcactgggaaaaaca
gttggccgtgtggccaacagaatcaagaattcccaattgaaatttgacggaaaagaatac
aaaatgacaccgaataatggtccacattatttacatggaggacccaatggattgggatat
agaaaatgggaattggtcagacacgcaccacaatcggtttcgttcagcgtgaaagccaat
gaacaggaggatggactgccgggagatgcgaaaattgatgtaacctacacagtaaacgac
cgtaatcaactaatcatcgagcatcatgcgacatgtgaaatcccgggacttctagccctc
acaaatcacgcctactggaatttagatggatcagaagacgtcaaagagcatttcttagaa
atggattctgaagaatacgtggaagttgatgacacattttgtccaacaggagcgattcga
tgtgtcaaagggaccagattcgattttcgaaatagaaaacaattgaaggcgtttggagaa
tcagaaaatgagattttggatttggataatgatttagtgatcgctagaaaagatccaccc
atcacgccgacgtcaaatttgagattctggagccagaaatcgggaatcgagttgtcaatc
accacttcctacccggttattcatttatatgcatcgaaatttttggattgttctggaaag
aatggagagcactacggagcaaataaagcgctggcaattgagccacagttccactcggct
gctcctaattttgaaaatttccccgacgtctcactccgtccaggtcaagactactgtcag
gaaatcgtgtacactttttctcatgtcaattga

DBGET integrated database retrieval system