KEGG   Caenorhabditis briggsae: CBG01302Help
Entry
CBG01302          CDS       T01054                                 

Definition
Hypothetical protein CBG01302
Orthology
K17861  
cytochrome P450, family 13
Organism
cbr  Caenorhabditis briggsae
Brite
Cytochrome P450 [BR:cbr00199]
 Cytochrome P450, animal type
  CYP13 family
   CBG01302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 547 aa AA seqDB search
MCPRWLPCMWGNTLCHDPIGYCQVSDTVLRMITISLAFLTLFVGVFSYYLWTWTYWKRRG
IPGPMGYPIFGSSLELFDSENPPPAQLEKWTKKYGKVYGMTQGLSKTLVISNADLVQEVL
VNQYDNFYGRNLNPIQGNPNQEKRVHLFAAQGHRWKRLRTISSPTFSNNSLRKLKTTVED
SCVELLRHMEEQTAGGKPIELLNFYQEFTLDVIGRIALGQTDSQIFKNPMLPYVRAVFGE
PRKALFMSGFLVPWIAPILRKIMFSFPSILKNPAVHIIRQTADAVEKRIAQRVADERVGI
EPGEPQDFIDLFLDAKSDDVDIQRNEEFSKTEKVTKKLTTDEVVGQCFVFLVGGFDTTAL
SLSFSSYLLATHPDVQKKLQEEVDRECKDPEITFDKLSKLKYMECVIKETLRLYPLAALA
NARRCMRPTTIGGVEIEKGVDILCDTWTIHKDPKIWGVDAEEFKPERWESGDDHILSKGS
FISFGLGPRQCIGMRLAYMEEKLLLCHILRKYTLKTCKKTQIPMKLVGVRTTQPESVWMN
LEPREDN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtgccctcggtggctcccttgcatgtggggtaacacattgtgccatgaccccattgga
tattgtcaagtgtcggatacagttctcagaatgatcaccatttctttagcattcttaact
ttatttgtaggagttttcagttactatctctggacctggacctattggaagcgtcgagga
attcccggacctatgggttaccccattttcggatcatctttggaacttttcgactctgaa
aatccaccacccgcccaactggaaaaatggaccaaaaagtatggcaaagtgtatggaatg
actcaaggactatcgaaaactttggtgatatcgaatgcagatttagttcaagaagtgttg
gtcaaccaatacgacaatttctatgggaggaacttgaatccaattcaagggaacccgaat
caggagaaacgagttcatctttttgcggcacagggtcatcggtggaagagattgagaaca
atttcgagcccgacgttttccaataatagtttgagaaaactaaaaacgacagtggaagat
agttgtgtggaacttttaaggcatatggaagaacagacggctggaggaaaaccaattgaa
cttttgaatttctaccaagaattcactctcgacgtcatcggtcgtattgccctcggacag
actgactctcaaatattcaaaaaccccatgctcccttatgtccgagctgtgttcggggag
cccagaaaggccctattcatgagtggatttttggttccatggatcgctccgattcttaga
aaaatcatgttctcgttcccaagcattttgaaaaatccagcagttcacatcatccgtcaa
accgctgacgctgtcgaaaaacgaatcgctcaacgagtggccgatgagagagtgggaatc
gagccaggagaaccgcaagacttcatcgatttattcttggacgccaaatctgatgacgtt
gatattcagagaaacgaagagttttcaaaaacagagaaagtgacgaaaaaattgactaca
gatgaagttgtgggacagtgctttgtattcctggtcggcggatttgacaccactgcatta
tccttatctttctcgtcttatcttctagctacacatccggatgttcagaaaaaacttcag
gaagaagtggatagagagtgcaaagatccagagatcacttttgataagctgtcaaaactg
aaatatatggaatgtgtgattaaagagaccctgaggctgtacccactggctgcactagcc
aacgctcgtcgctgtatgcggcccaccacaattggaggtgttgagattgagaagggtgta
gatattctctgtgacacgtggaccatccacaaagatccaaaaatctggggagtagatgca
gaagaattcaagcctgaaaggtgggaatctggagacgaccatattctctcaaaaggatca
ttcatctcgtttggccttggaccccgtcagtgtattggaatgcggttggcttatatggaa
gagaaacttttactgtgccacattttgagaaaatacacattgaaaacttgcaagaaaact
cagattcctatgaaactggttggtgtgagaactactcaaccggagagtgtgtggatgaat
ttggaacccagggaggataattaa

DBGET integrated database retrieval system