KEGG   Caenorhabditis briggsae: CBG01494Help
Entry
CBG01494          CDS       T01054                                 

Gene name
Cbr-nrs-2
Definition
C. briggsae CBR-NRS-2 protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 554 aa AA seqDB search
MCGIWAIIGEQVTPQQQDAFMKIVGRGPDLTVLDEVQPNVHLGFHRLAIVMPGDTPSAQP
IVGGGLSVVCNGEIYNHQSLKIDCPYTLKNGGSDCAAIITSFIKHNEDLKETCASLDGVF
AFIMADSKNVYIGRDPIGVRPLFYGYNLNGSLLIGSEVKCIEELCERVEYFPPGCCATIS
LAAPSRPIQPQQYYSVPSIADRFLSIECTQTLVRDILVKSVEKRLMGNRNFGFMLSGGLD
SSLIASIATRFLKQKPVAFSVGFEDSPDLEAARKVADYLKIPHEVLVITPQQCVDIIPEV
VFALETFDPLIIRCGIAHYLLCQHISKSSDVKVLLSGEGADELFGSYAYMQRAPNALHLH
KEILRRMQHLHQYDVLRCDRSTSCHGLEIRVPFLDKRFIDLVSRLPPTYKLMPMKLEKHL
LRSAFEGWLPDEVLWRSKEGFAEALGKTDLGDILASHCDKLISKELYEQRAERFPDRTPE
TTEEYWYRQIFEETFVYDKMGHLVHTKVYRTAAWHRPDEKENIINSPDSENILDVKSDDL
LRLRRRSTGSLGVA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttgggccataattggcgaacaagtcaccccacaacagcaggatgcgttc
atgaagatcgtgggccgtggtccagatcttactgtactggatgaggtccaaccgaatgta
catttgggattccatcgcttagcaattgttatgcccggagatactccaagcgctcaacca
attgtcggcggcggtttgtctgtcgtttgcaatggagagatctacaaccatcagtcgctg
aagatcgattgcccttacactttgaaaaatggtggaagcgattgtgcagcaatcattacg
tcattcatcaagcacaatgaagacctcaaggagacctgcgcttcgttagatggagtcttc
gctttcatcatggcagactcaaagaacgtctacatcggacgagaccccatcggagtcaga
ccacttttctatgggtacaatttgaacggttcccttctcattgggtccgaagtcaaatgt
attgaggaattgtgcgagagagtggaatatttcccacctggatgctgtgcgacgatcagc
ttggcagctccgagcagacctattcagccacagcagtactattcggttccaagcattgcg
gatagatttttgagcattgaatgcacacaaaccttggttcgagatattctcgtaaagtct
gttgagaaacgattgatgggaaatcgcaacttcggattcatgttgtcaggaggacttgat
tcctcgctgatcgcttccattgccaccagatttttgaagcagaaaccagtcgctttctcg
gttggatttgaagactctccggatctcgaggccgctcggaaagtggctgactacctgaaa
atcccacatgaagttctcgtgatcacgccacagcaatgtgttgatattattccagaggtg
gtattcgctctggaaacatttgacccactgatcatccgatgtggaatcgcccactatctc
ctttgtcaacacatctcaaagagctcagatgtgaaggttctgttatcaggagagggagca
gatgagctcttcggaagttatgcttatatgcaaagagcaccaaatgctcttcacctccac
aaggaaatcctccgcagaatgcaacatctccaccagtacgatgtgctccgctgcgatcgt
tccacctcttgccatggccttgaaatccgtgttccattccttgacaaaagattcattgac
ctagttagccgtcttccaccaacctacaaattgatgccaatgaaattggagaaacatctg
ttgagaagtgcctttgaaggatggttgccggatgaggttctttggagaagcaaggaagga
tttgctgaggctctgggaaaaactgatttaggtgatattttggctagtcattgtgataag
ctgatttcgaaggaattgtacgagcaacgggcggagcgctttccggacaggacgccagaa
acgacagaggaatattggtatcgccagattttcgaggaaacttttgtctatgataagatg
ggacacttggtgcacaccaaggtttatagaaccgctgcttggcaccgacccgacgagaaa
gagaacatcatcaattcccccgattccgaaaacatcctggacgtgaaatccgacgacctc
ctccgactacgccgacgatcgactggatcccttggtgttgcgtaa

DBGET integrated database retrieval system