KEGG   Caenorhabditis briggsae: CBG01554Help
Entry
CBG01554          CDS       T01054                                 

Gene name
Cbr-pmk-2
Definition
(RefSeq) C. briggsae CBR-PMK-2 protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04010  MAPK signaling pathway
cbr04068  FoxO signaling pathway
cbr04212  Longevity regulating pathway - worm
cbr04933  AGE-RAGE signaling pathway in diabetic complications
Module
cbr_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG01554 (Cbr-pmk-2)
   04068 FoxO signaling pathway
    CBG01554 (Cbr-pmk-2)
 Organismal Systems
  Aging
   04212 Longevity regulating pathway - worm
    CBG01554 (Cbr-pmk-2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CBG01554 (Cbr-pmk-2)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CBG01554 (Cbr-pmk-2)
Protein kinases [BR:cbr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CBG01554 (Cbr-pmk-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 8576016
NCBI-ProteinID: XP_002634021
WormBase: CBG01554
Position
IV
AA seq 280 aa AA seqDB search
MAVKMGDFPGTFIADLGPAPVEITPEGYHEIELNKTKWVIPHWYNSLRALGEGAYGVVCT
AEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLN
YVYFVSVLMGSDLQNILKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNE
RCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDIWSVGCILAELVSGR
PLFPGDDHIDQLTKIMSVVGTPQEDFWSKIQSEEARNYIK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaagatgggcgactttcccggaaccttcatcgcagatctaggccccgcgcct
gtagaaatcactccagaaggctatcatgagattgaactcaacaagaccaaatgggtgata
cctcactggtacaacagtttgcgagcactgggagagggtgcctatggagttgtgtgcaca
gccgaatacgaacccactggagaccgagtggcgattaaaaaattctttcggccatttcaa
agtacaattcatgcaaaaagaacgtatcgagaactgaaattgttacgaacattgcagcat
gataatgtgctggaaatgatagatgtattcactccagatcccgatgcttcgtctttaaat
tatgtatactttgtgtccgttctgatgggctccgatcttcaaaacattctaaaaattcaa
cggctgactgatgaacaaattcaacttctcatctatcaagtgctgcgtgggctaaagtat
attcattcggctgggattatccatcgagacctaaagccatcgaatatcgccgtcaacgaa
agatgcgaagtcaagattttggattttggcctagctcgtgctcaggatgccgaaatgaca
ggatacgtcgcgacaagatggtatagagcccccgagattatgctcaattggatgcattat
acacagacagttgacatttggtcagtcggatgcatcctagcggaacttgtctccgggcga
ccactgtttccaggtgacgatcatattgaccaactaacgaaaattatgtcagtagttggg
actccacaagaagatttttggtcgaaaattcaatcggaggaagctcgaaattatatcaag
tga

DBGET integrated database retrieval system