KEGG   Caenorhabditis briggsae: CBG01744Help
Entry
CBG01744          CDS       T01054                                 

Gene name
Cbr-cyc-2.1
Definition
C. briggsae CBR-CYC-2.1 protein
Orthology
K08738  
cytochrome c
Organism
cbr  Caenorhabditis briggsae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CBG01744 (Cbr-cyc-2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 112 aa AA seqDB search
MADIPAGDYEKGKKVYKQRCLQCHVVDSTATKTGPTLYGVIGRTSGTVAGFDYSAANKSK
GVVWTRETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEVECSKPLA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatcccagctggagattacgaaaagggaaagaaggtgtacaagcagagatgc
ttgcaatgccacgtcgttgattccaccgccacaaagaccggaccaaccctttacggagtc
atcggacgtacctctggaacagtcgctggattcgactattctgctgctaacaagagcaag
ggagtcgtctggactcgtgaaaccctcttcgagtaccttctcaacccaaagaagtacatc
ccaggaaccaagatggtgttcgctggactcaagaaggctgatgaacgtgctgatcttatc
aagtacatcgaggtggaatgctccaagccactcgcctaa

DBGET integrated database retrieval system