KEGG   Caenorhabditis briggsae: CBG01782Help
Entry
CBG01782          CDS       T01054                                 

Definition
Hypothetical protein CBG01782
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cbr  Caenorhabditis briggsae
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cbr03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:cbr03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 156 aa AA seqDB search
MITFQSSWILLEVCSDRRAAQSLGIHKLFLYGIRCAIPVKNVYPYVNNTIKTWTVDHQSS
HAKNQIIFISLAKTAEEMLNNSFDEIYIHGMGASVNKALVFAMEVERKFGGSVKSDIQTS
TVQCTDDIISLLDLDQTDTRHRSVSAVHVHLYRAAS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgataacttttcagtcttcttggattcttctggaagtgtgctcggatcggagagcggct
cagtccttgggtatccataagttgtttctgtatggcattcgttgtgctattcctgtgaaa
aatgtctatccatatgtcaacaacaccatcaaaacgtggaccgtcgaccaccagtcaagc
catgcgaagaaccaaatcatatttatatcactagcaaaaaccgccgaagagatgcttaac
aactcatttgacgaaatctacatccatggaatgggtgcatctgtgaacaaagccttggtt
tttgccatggaagttgaaaggaagtttggaggaagtgtgaaatctgatattcaaacatca
actgtgcagtgtaccgatgacattatatcacttttggacttggatcaaaccgatactcgt
caccgatcagtttctgctgtacatgttcatctctatcgtgctgcctcataa

DBGET integrated database retrieval system