KEGG   Caenorhabditis briggsae: CBG01782Help
Entry
CBG01782          CDS       T01054                                 

Definition
Hypothetical protein CBG01782
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cbr  Caenorhabditis briggsae
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CBG01782
   03008 Ribosome biogenesis in eukaryotes
    CBG01782
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     CBG01782
Ribosome biogenesis [BR:cbr03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     CBG01782
Transfer RNA biogenesis [BR:cbr03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    CBG01782
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    CBG01782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 156 aa AA seqDB search
MITFQSSWILLEVCSDRRAAQSLGIHKLFLYGIRCAIPVKNVYPYVNNTIKTWTVDHQSS
HAKNQIIFISLAKTAEEMLNNSFDEIYIHGMGASVNKALVFAMEVERKFGGSVKSDIQTS
TVQCTDDIISLLDLDQTDTRHRSVSAVHVHLYRAAS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgataacttttcagtcttcttggattcttctggaagtgtgctcggatcggagagcggct
cagtccttgggtatccataagttgtttctgtatggcattcgttgtgctattcctgtgaaa
aatgtctatccatatgtcaacaacaccatcaaaacgtggaccgtcgaccaccagtcaagc
catgcgaagaaccaaatcatatttatatcactagcaaaaaccgccgaagagatgcttaac
aactcatttgacgaaatctacatccatggaatgggtgcatctgtgaacaaagccttggtt
tttgccatggaagttgaaaggaagtttggaggaagtgtgaaatctgatattcaaacatca
actgtgcagtgtaccgatgacattatatcacttttggacttggatcaaaccgatactcgt
caccgatcagtttctgctgtacatgttcatctctatcgtgctgcctcataa

DBGET integrated database retrieval system