KEGG   Caenorhabditis briggsae: CBG01940Help
Entry
CBG01940          CDS       T01054                                 

Gene name
Cbr-mkk-4
Definition
C. briggsae CBR-MKK-4 protein
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG01940 (Cbr-mkk-4)
   04012 ErbB signaling pathway
    CBG01940 (Cbr-mkk-4)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CBG01940 (Cbr-mkk-4)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CBG01940 (Cbr-mkk-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 360 aa AA seqDB search
MVQEDDDTSRISMSLNPSLSNRPNTLSVNGNNEKAIPEENVLRSLSTGTLKYPEDEHFYT
FNSAHLQDLGAIGNGNFGTVYKMRHRETGKLLAVKRIRCNNIDQREQIRLLREHDTIVKS
EKGPNIVKFYGAIFSEGDCWICMELMDISMDLLYRRVYNVKGSRLNENVIGHITVCTVDA
LDYLKKELKIIHRDVKPSNILVDGHGSVKLCDFGICGELEDSVVKTHDAGCQPYLAPERI
TSSDKYDVRSDVWSLGITLYEIATGRFPYPQWNSVFEQIAAVVSGDPPMLSPDTGDFSYS
LPLIKFINTCLMKDRRHRPKYDTLKNFDFYRIYARGGPEIEEAKEILGVEAIDAREHPID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagaagatgacgacacttcgcgcatctcaatgtccctcaacccttcattgtcc
aaccgccctaatacgttgtcggtaaacgggaataatgagaaagccatacccgaagaaaac
gtcctacgatcactatccactggcaccttaaaatatccagaggacgaacacttttacacg
tttaactctgctcatttacaagatttgggggcgattggaaatggaaattttgggacagta
tacaaaatgagacatcgtgaaactggaaaattgttagctgtaaaaaggatacgatgtaac
aacatagaccagcgcgaacaaatccgcttactacgagagcatgacacaattgtgaaatcc
gagaaaggcccgaatatagtaaagttctacggagcaattttcagtgaaggagactgctgg
atctgcatggagttgatggatatatcgatggatctgctttatcggagagtgtacaacgta
aaaggaagcaggctgaatgaaaatgtaattgggcatattaccgtttgcaccgtcgatgcc
cttgattacctaaaaaaagagcttaaaatcattcatcgtgatgtgaaaccatcaaatatc
ctagtcgatggtcatggatctgtgaaactttgtgacttcggaatctgtggagagcttgag
gattctgtagtaaagactcatgatgctgggtgccagccgtatctagcgccagaacgaata
acaagctcggacaagtatgacgtgaggtcggacgtctggtcattgggaatcactttgtat
gaaattgctactggtcggtttccatatccccaatggaattcagtgttcgagcagattgca
gcggtcgtcagtggcgatccgccaatgttgagcccggatactggagatttcagctacagt
ctgcccctgattaaatttatcaatacatgtttgatgaaagacaggcggcatcgaccaaag
tatgacacgctgaaaaactttgacttctacagaatatacgcccgaggaggacctgaaatc
gaggaagccaaagaaattctgggcgtcgaagcgatcgatgctcgtgaacatcccatagac

DBGET integrated database retrieval system