KEGG   Caenorhabditis briggsae: CBG02020Help
Entry
CBG02020          CDS       T01054                                 

Definition
Hypothetical protein CBG02020
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 814 aa AA seqDB search
MAEDNSMISPEELELIHQRTLRRFDSIVPTSGREGEEISSDIFKGRTLAIYTSGGDSQGM
NSAVRSITRMAIYCGCKVYLIYEGYEGMIEGGDFIKEATWNTVSDIIQQGGTIIGSARSS
EFRTREGRLKAATNLINRGIGRLVCIGGDGSLTGANTFRLEWTDLVQELVRTDRVTPAMA
KKIPYIQIVGLVGSIDNDFCGTDMTIGTDSALQRIISSIDAVVATAQSHQRAFVIEVMGR
HCGYLALVAALASEADFCFIPEWPAPENWRDVLCDKLSQMRSEGQRLNIIIVAEGAIDRD
GKPITAEDVKTAVKNKLKYDTRVTILGHVQRGGAPSAFDRLLGCRMGAEAVFALMEMTEE
SEPCVISIDGNVMVRVPLTKCVERTQMVQKAMADKDWDTAVALRGRSFQRNLDTYKLLTK
MRTVEKDNLSGGHKFNVAVINVGAPAGGMNAAVRSYVRMALYHQCTVFGIEDSFEGLANG
SFKQFKWSDVTNWAMYGGSFLGTQKSLPTAETMPKIAEQLKKHNIQALLLVGGFEAYHST
ILLAEARDKFPEFCIPMCVIPCTISNNVPGTMVSLGSDTAINEICQMIDKIKQSATGTKR
RVFIVETMGGYCGYLATLSAISSGADNAYIFEEPFTVQDLSDDVDVILSKMEVGAKRYLV
VRNEWADKNLTTDFVQNLFNSEGKKQFTTRVNVLGHVQQGGSPTPFDRNMGTKLAARALE
FLLIQLKENLTGDNKVIAKTPHTATLLGLKGRKVVFTPVQDLKKETDFEHRLPTEQWWLA
LRPLLRVLARHRSTVESSAVLESVQEEDADTHMF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacaactcaatgatctctccagaagagctggaactcatccaccaacgtact
cttcgccgtttcgactcgatcgtcccaacttctggcagagaaggagaagagatttcatcg
gacattttcaagggacgcactcttgctatttacacatccggaggagactctcaaggaatg
aacagcgctgtgcgcagtatcactcgtatggccatctactgtggttgcaaggtctatctg
atctatgagggatacgagggaatgatcgagggtggtgatttcatcaaggaggccacatgg
aacacggtttcggatatcatccaacaaggaggaactatcataggatcagctagatcttca
gagttcagaactcgtgaaggacgtttgaaggccgccaccaacctcatcaaccgtggaatc
ggacgtctcgtatgcattggaggagatggatctctcaccggagccaacactttccgtctc
gagtggaccgatcttgtccaggagctcgtccgcactgaccgcgtcaccccagccatggcc
aagaagattccatacatccagattgttggacttgtcggatccattgacaacgatttctgt
ggaactgatatgaccattggaaccgactcggctcttcagcgtatcatcagttcgattgat
gctgtggttgccactgcacagagtcatcagagagctttcgttattgaggtcatgggccgt
cattgtggttaccttgcgttggttgctgcgttggcttctgaagcagacttctgtttcatc
cctgaatggccagcaccagagaactggcgtgatgtgttgtgcgacaaactatcccagatg
agatccgaaggacaacgcttgaacatcatcattgttgccgaaggagctattgatcgggat
ggcaagcccataactgctgaagatgtcaagacagcagtcaagaataagttgaagtacgat
actcgcgtcactattctgggacacgttcaacgtggaggtgctccatcagcattcgatcgt
cttcttggatgcagaatgggtgctgaagcggtgttcgcattgatggagatgactgaggag
tcagagccttgtgtcatttcgattgatggaaatgtgatggtccgagttcccttaaccaag
tgtgttgagcgtactcaaatggttcaaaaggcaatggcagacaaagactgggatactgct
gtcgctctccgtggtcgtagtttccagaggaaccttgacacttacaaacttctcaccaag
atgagaactgtcgaaaaagataacctctcgggagggcacaagttcaacgttgctgtcatc
aacgtcggagcaccagccggaggaatgaacgctgcagttcgctcctatgtcagaatggct
ctctaccatcagtgcacagtgttcggtattgaagacagcttcgaaggtcttgccaatgga
tccttcaaacagttcaaatggtctgatgtcaccaactgggcaatgtacggaggatcgttc
ctgggtactcagaagagtcttccaactgctgaaacgatgccaaagattgccgagcaactt
aagaagcacaacatccaggctcttctgcttgttggaggttttgaagcctatcacagcacc
attcttctggctgaggctcgtgacaagttcccagagttttgtattccaatgtgcgtgatt
ccatgcaccatctccaataacgttccaggaacaatggtgtcccttggatccgacactgct
atcaatgaaatctgtcaaatgatcgacaaaatcaagcaatctgccactggaaccaaacgt
cgtgtgtttatcgtggaaactatgggaggatactgtggatatctggccactctctctgcc
ataagttccggagccgacaacgcctacatcttcgaggagccattcaccgttcaagacctc
tctgatgacgttgatgtcattctttccaagatggaagttggtgccaagcgttacctggtt
gttcgaaacgagtgggctgacaagaacctgaccaccgatttcgtgcaaaatctgttcaat
tcggaaggaaagaaacagttcaccactcgtgtcaacgttctgggacacgttcaacaggga
ggatcaccaactccattcgacagaaatatgggcaccaagttggccgcgcgcgctttggag
ttcttgctgattcagctcaaggagaatctgaccggagacaacaaggtcatcgctaaaact
ccacataccgccactcttctcggtctcaagggtcgaaaggttgtgttcacgccagttcaa
gatctcaaaaaagagactgactttgagcatcgtcttccaaccgaacaatggtggctcgca
ctccgcccactcctccgtgttctcgcccgtcatcgttccactgttgagagctccgccgtg
ctcgagtctgtccaagaggaagacgccgacacccatatgttctaa

DBGET integrated database retrieval system