KEGG   Caenorhabditis briggsae: CBG02020Help
Entry
CBG02020          CDS       T01054                                 

Definition
Hypothetical protein CBG02020
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBG02020
   01230 Biosynthesis of amino acids
    CBG02020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG02020
   00030 Pentose phosphate pathway
    CBG02020
   00051 Fructose and mannose metabolism
    CBG02020
   00052 Galactose metabolism
    CBG02020
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CBG02020
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CBG02020
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBG02020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 814 aa AA seqDB search
MAEDNSMISPEELELIHQRTLRRFDSIVPTSGREGEEISSDIFKGRTLAIYTSGGDSQGM
NSAVRSITRMAIYCGCKVYLIYEGYEGMIEGGDFIKEATWNTVSDIIQQGGTIIGSARSS
EFRTREGRLKAATNLINRGIGRLVCIGGDGSLTGANTFRLEWTDLVQELVRTDRVTPAMA
KKIPYIQIVGLVGSIDNDFCGTDMTIGTDSALQRIISSIDAVVATAQSHQRAFVIEVMGR
HCGYLALVAALASEADFCFIPEWPAPENWRDVLCDKLSQMRSEGQRLNIIIVAEGAIDRD
GKPITAEDVKTAVKNKLKYDTRVTILGHVQRGGAPSAFDRLLGCRMGAEAVFALMEMTEE
SEPCVISIDGNVMVRVPLTKCVERTQMVQKAMADKDWDTAVALRGRSFQRNLDTYKLLTK
MRTVEKDNLSGGHKFNVAVINVGAPAGGMNAAVRSYVRMALYHQCTVFGIEDSFEGLANG
SFKQFKWSDVTNWAMYGGSFLGTQKSLPTAETMPKIAEQLKKHNIQALLLVGGFEAYHST
ILLAEARDKFPEFCIPMCVIPCTISNNVPGTMVSLGSDTAINEICQMIDKIKQSATGTKR
RVFIVETMGGYCGYLATLSAISSGADNAYIFEEPFTVQDLSDDVDVILSKMEVGAKRYLV
VRNEWADKNLTTDFVQNLFNSEGKKQFTTRVNVLGHVQQGGSPTPFDRNMGTKLAARALE
FLLIQLKENLTGDNKVIAKTPHTATLLGLKGRKVVFTPVQDLKKETDFEHRLPTEQWWLA
LRPLLRVLARHRSTVESSAVLESVQEEDADTHMF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacaactcaatgatctctccagaagagctggaactcatccaccaacgtact
cttcgccgtttcgactcgatcgtcccaacttctggcagagaaggagaagagatttcatcg
gacattttcaagggacgcactcttgctatttacacatccggaggagactctcaaggaatg
aacagcgctgtgcgcagtatcactcgtatggccatctactgtggttgcaaggtctatctg
atctatgagggatacgagggaatgatcgagggtggtgatttcatcaaggaggccacatgg
aacacggtttcggatatcatccaacaaggaggaactatcataggatcagctagatcttca
gagttcagaactcgtgaaggacgtttgaaggccgccaccaacctcatcaaccgtggaatc
ggacgtctcgtatgcattggaggagatggatctctcaccggagccaacactttccgtctc
gagtggaccgatcttgtccaggagctcgtccgcactgaccgcgtcaccccagccatggcc
aagaagattccatacatccagattgttggacttgtcggatccattgacaacgatttctgt
ggaactgatatgaccattggaaccgactcggctcttcagcgtatcatcagttcgattgat
gctgtggttgccactgcacagagtcatcagagagctttcgttattgaggtcatgggccgt
cattgtggttaccttgcgttggttgctgcgttggcttctgaagcagacttctgtttcatc
cctgaatggccagcaccagagaactggcgtgatgtgttgtgcgacaaactatcccagatg
agatccgaaggacaacgcttgaacatcatcattgttgccgaaggagctattgatcgggat
ggcaagcccataactgctgaagatgtcaagacagcagtcaagaataagttgaagtacgat
actcgcgtcactattctgggacacgttcaacgtggaggtgctccatcagcattcgatcgt
cttcttggatgcagaatgggtgctgaagcggtgttcgcattgatggagatgactgaggag
tcagagccttgtgtcatttcgattgatggaaatgtgatggtccgagttcccttaaccaag
tgtgttgagcgtactcaaatggttcaaaaggcaatggcagacaaagactgggatactgct
gtcgctctccgtggtcgtagtttccagaggaaccttgacacttacaaacttctcaccaag
atgagaactgtcgaaaaagataacctctcgggagggcacaagttcaacgttgctgtcatc
aacgtcggagcaccagccggaggaatgaacgctgcagttcgctcctatgtcagaatggct
ctctaccatcagtgcacagtgttcggtattgaagacagcttcgaaggtcttgccaatgga
tccttcaaacagttcaaatggtctgatgtcaccaactgggcaatgtacggaggatcgttc
ctgggtactcagaagagtcttccaactgctgaaacgatgccaaagattgccgagcaactt
aagaagcacaacatccaggctcttctgcttgttggaggttttgaagcctatcacagcacc
attcttctggctgaggctcgtgacaagttcccagagttttgtattccaatgtgcgtgatt
ccatgcaccatctccaataacgttccaggaacaatggtgtcccttggatccgacactgct
atcaatgaaatctgtcaaatgatcgacaaaatcaagcaatctgccactggaaccaaacgt
cgtgtgtttatcgtggaaactatgggaggatactgtggatatctggccactctctctgcc
ataagttccggagccgacaacgcctacatcttcgaggagccattcaccgttcaagacctc
tctgatgacgttgatgtcattctttccaagatggaagttggtgccaagcgttacctggtt
gttcgaaacgagtgggctgacaagaacctgaccaccgatttcgtgcaaaatctgttcaat
tcggaaggaaagaaacagttcaccactcgtgtcaacgttctgggacacgttcaacaggga
ggatcaccaactccattcgacagaaatatgggcaccaagttggccgcgcgcgctttggag
ttcttgctgattcagctcaaggagaatctgaccggagacaacaaggtcatcgctaaaact
ccacataccgccactcttctcggtctcaagggtcgaaaggttgtgttcacgccagttcaa
gatctcaaaaaagagactgactttgagcatcgtcttccaaccgaacaatggtggctcgca
ctccgcccactcctccgtgttctcgcccgtcatcgttccactgttgagagctccgccgtg
ctcgagtctgtccaagaggaagacgccgacacccatatgttctaa

DBGET integrated database retrieval system