KEGG   Caenorhabditis briggsae: CBG02215Help
Entry
CBG02215          CDS       T01054                                 

Gene name
Cbr-duo-3
Definition
C. briggsae CBR-DUO-3 protein
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG02215 (Cbr-duo-3)
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG02215 (Cbr-duo-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 860 aa AA seqDB search
MTEEWVSRVLDVFIQTQANKSISLTDHLLKLNPDNVEISNRSQTETRRRVYYTKIVFKKI
ENEKSITIIFKGSEDSFWKLQPKSSESLAMLKLKMNETFEANKSRMAIPHSASKSRQVPS
LYSENSANRTIRELDKHSETSPSIRNLTPSVSYKYQPTVSTLKSTSSPNTPKSIHSVPHT
SSINSSYYVPDKTKNLPNSSTTYSQNKEYKPLQPTRRVYDYSSKQKIYSYRSLHNIKNTC
YFNATLQALASCPSMVSRFHQMSLIMERIKLRSFYSENTDIKNKLALFVGFQKVFMFLTK
PEKSTESFNRDELKRILENLNKVISGFIYDKQQDVQEFLDFTFHAIDDIMKNEMPRKEAI
GDESSVFYGGSIASLNPLLPMRYSIESSKSCCKCDDESTVIAVDHFLRVSMQPSDGFTSV
ELTDLITNDFKAKKVERDCSKCKCESAISRDRFVTFPQCLAVHLKRSCRDENQTNYKNEH
DIKIRLELDLSKYSSFCPIAENANTSSSKLSVKNFNSNLEKNHTPLKVLGGAREVSLDTE
EVQFDNEIINHSLHFKPLRSYPNIVRMLEELDIKYDDAILRTHVKKLAKIRPSDMTKNDE
PDQIQEIEADGNCFFRAISWCLTGSEAHHKKLRRATADYLKDNKPALKKYQSNFEAHAKK
MKQNAEWATNCEVAAISKMLSVNIYTYLSSGWTCQSPSNNEVTVVGSIYLNNVSEHYEPV
LSLRKGQSEARSIRAQKRSAPDSDDEKSMDDNDESFKPARPKMNGDSKTSRKEASSSKGF
VNDKKTNTTTKDNELASYNLVAVICHYGPSVLAGHYITFSKSIYCDEWLKCDDETITPVS
KNTVLTEATSAGYLIFYDRK
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaatgggtttcgagagtattagatgtatttattcaaactcaggcaaataag
tcgatatccctgacggatcatttgctaaaactcaatccagataatgttgaaatatcgaac
cgatcccagacggaaacacgaagaagggtttactacacaaaaatcgtattcaagaaaatt
gaaaacgagaaaagtattacaattattttcaaaggttcagaagatagtttttggaaattg
caaccaaagagttcggaaagtttagctatgctgaaacttaagatgaacgaaacttttgaa
gcgaacaaatctagaatggcaataccacatagtgcgagtaaatccagacaagttccgtca
ctctacagtgaaaattcagcaaataggactatcagagaattggataaacattcggaaact
tctccaagtatacgcaatctaactccatcagtctcctataaataccaaccgactgtgtcc
accctcaaatccacctcgtctccgaatacacctaaaagcattcacagcgttcctcacaca
tcgtcaatcaattccagttattatgttccggataagacaaaaaatttgccaaactcgtca
acaacttattcacagaacaaagaatataaaccgttgcaaccaacaagaagagtttatgac
tattcatcgaagcagaaaatttattcataccgcagtttgcataacatcaaaaacacttgt
tatttcaatgcaacattgcaagccctcgcttcatgtccgtcaatggtttctcgatttcat
cagatgtcgttaattatggagagaataaaactcagaagtttctatagtgaaaataccgac
ataaaaaacaaacttgcattgtttgttgggttccagaaggttttcatgtttttgactaaa
ccagaaaagagtacagaatcttttaatagagatgaactcaaacgtattcttgaaaacctg
aacaaagttatctctggctttatctacgacaaacagcaagatgttcaagaattcctagat
tttacgttccatgcaatcgacgatataatgaagaatgaaatgccacggaaagaagctatt
ggtgatgaaagttctgtgttttatggaggcagcattgcttcattgaatcctcttctgcca
atgcgctactccattgaatcctctaaaagctgttgtaaatgtgacgacgaaagcacagtg
attgcagttgatcattttctccgtgtttctatgcagccttctgatggtttcacttcagta
gaattaactgatttgattacgaatgatttcaaagcaaaaaaagttgaacgagactgttca
aaatgcaaatgcgaaagtgccattagcagagatcgattcgtcacttttcctcaatgcctt
gctgtacacctgaaacgttcgtgtcgagatgaaaatcagactaattacaaaaatgaacat
gacatcaaaattcgtctcgaactggatctctcgaaatattcctcgttctgtccaatcgcg
gaaaatgcaaatacatcgtctagtaaactttctgtcaaaaacttcaacagcaatctcgaa
aagaatcatactcctctaaaagtgctaggaggtgcacgagaagtctcactggacactgaa
gaagttcagttcgacaacgagattatcaatcattcgttgcattttaagccactgcgttct
tacccgaacatagtgaggatgttggaggaacttgacattaaatacgacgatgccattttg
agaacccacgtcaaaaagctcgcgaagatcagaccatctgacatgacgaagaacgacgaa
ccagaccaaatccaagaaattgaagccgatggtaattgctttttccgtgccatctcctgg
tgtttaactggttccgaggcacatcacaaaaagttacggagagcaactgctgattatctt
aaagataataaaccagctctgaaaaagtaccaaagtaacttcgaagcacatgcgaagaaa
atgaagcagaatgcagaatgggcgactaattgcgaagttgctgccatttctaaaatgctg
agtgtaaacatctatacatatctgtctagtggttggacttgtcaatccccatcaaacaac
gaagttactgtcgttggatcaatatatttgaacaatgtttcggagcactacgagccggtt
ctatcgctgagaaaaggacaatccgaagcccgaagtatcagggcacaaaaaaggtctgct
cctgatagtgacgacgagaagagtatggatgataacgatgaatccttcaagcctgctaga
ccgaaaatgaatggagattctaaaacttcgagaaaggaagcatcatcctcgaaaggattc
gtgaatgataagaaaacaaatacgacgacgaaggacaacgagcttgctagttataacctt
gttgctgtcatctgtcattatgggccgtctgttctcgcaggacactatattactttttcg
aaaagcatctattgcgatgaatggttgaaatgcgacgatgaaacgattacgcctgtttct
aaaaatacagttctcactgaggcaacgtctgctggctacctcatattctatgatcgaaaa
tag

DBGET integrated database retrieval system