KEGG   Caenorhabditis briggsae: CBG02629Help
Entry
CBG02629          CDS       T01054                                 

Gene name
Cbr-set-4
Definition
C. briggsae CBR-SET-4 protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cbr  Caenorhabditis briggsae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CBG02629 (Cbr-set-4)
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CBG02629 (Cbr-set-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 326 aa AA seqDB search
MSHAPGEGRPVSSLFPARCNEEVASQNATTMATLNEIELSEIEELSLNFKETPRQDHSMT
PVELCYFDDFATTLVVDAVLNFSTHKMCKKRRYLYGDEQRVARELMERFRKDQDWTPAIY
GFLNMRSVRSFIEKLAFNKQLEFRDHIIRFLNVFHHDSGYTIQECTRYSLEGNQGAKLVA
TRAWYRGDKIQRLSGVVCLLSTQDEDTILQPEGSDFSVMYSNRKRCSTLWLGPGAYINHD
CRPTCEFVSHGSTAHIRVLRDMVAGDEITCFYGSEFFGPKNMDCECLTCEKTKRGKFSTS
DEEENDEPSALSEKRIKYGLRSRSRV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgcgccaggagaaggtcgtcccgtttcttcgctcttcccagcgcgctgcaac
gaggaggtggcttctcaaaacgcgacaacaatggcaacgctcaacgagatcgagctgagc
gagattgaagaactatctctgaacttcaaagagactcctcgccaagatcattcgatgaca
ccagttgaattgtgctactttgacgatttcgccaccactcttgtcgtagacgctgtgctc
aatttctcaacacacaaaatgtgcaagaaacggcgatatctatacggagatgagcagaga
gtagctcgagaactcatggagcgcttcagaaaagatcaggattggactccagcgatatat
gggtttttgaacatgagaagtgttcgttcattcatcgaaaagttagcattcaacaaacag
ctcgagtttcgtgatcatatcatacgattcctcaatgtctttcaccacgattcagggtac
accattcaagaatgcactcgttattcactggaaggcaatcagggcgcgaagctcgttgcg
acacgtgcttggtatcgcggcgacaagattcaacgactcagcggcgtcgtttgtctactt
tcaacacaagacgaagatactatactccagccagaaggcagcgatttctccgtgatgtac
agtaacagaaagcgctgctcaactctctggctagggccaggagcctacataaaccacgac
tgcaggccaacttgcgaattcgtttcacatggaagtactgctcacataagagtcctccgc
gatatggttgccggcgatgaaatcacgtgtttctatgggagcgagttcttcggcccgaaa
aacatggactgtgaatgcctcacttgtgagaagacaaagcgtggaaagttcagcacatcc
gacgaggaggagaacgacgaaccatctgcactgtccgagaagcgtataaaatatggactt
cgttctagatcccgcgtttag

DBGET integrated database retrieval system