KEGG   Caenorhabditis briggsae: CBG02744Help
Entry
CBG02744          CDS       T01054                                 

Gene name
Cbr-npp-3
Definition
C. briggsae CBR-NPP-3 protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CBG02744 (Cbr-npp-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 1699 aa AA seqDB search
MWKDIRDFHEYVTTFTDFDDDDKLSQLLVRLEQYKWRMINLLSNPKRTPEEKAKAQNEKL
EVEGVELSRFEQLSEEAKILSDVFELRVNEACDLILAGEAQKMHFEGLNRGLCAVVCYYD
AHRLLAAVVRQMLKWDREDVPSQVTEFLDGAFIHENMIKMLFQRLNTFNVQSVFALLQNP
EVNGLGGSKHQKLLRNVIEETRTEIIQCISSICEFPGSHAVHISNYLFQLVKAAPPEKLS
VGNLTAWVSLIKLTSSEVLSQVPDATQVLTSMIGHIRNETDWADQALCGTLQLACAVSLK
SIASSPSDHLGIENIKVDVERVIDRAIRNMAFHYLRQAIIKSEHFRFAHQFIIIDELLKQ
LVSYFPAKLMETERNSTDELNFLDDQKEAATPASTKKPDPRNQTVNLNDKVTAQLSTTDP
TNNYDSALSNYENFLRCFVDLYEMQVTDYVHQRMPKTYRERELQEQIEESSMSFSTERSI
ELCRLLERARIPNHHVVHSVAYLELCAAVCKNQLTAGLLFDIFSRELSGPDTYGWESLTG
ALKGYDRLYREQKSVTNSRFNQNQTVNMSTSFQQSQNNQSLNINLRPGDKIKIPAQELSG
LVAWLRMATKVAQFNERAATRFSDDPSWTMCAAAASLSTSSVPLALKAALIDLLTSVARL
KQTAPRIWHVIHQNQLCYVEGDRLRGLQEELEMRECIEKQYDVSLAFVKLMTTLLMHRSL
PEYATPFIKFVTQSILGHFLFRSYNNVVQMWELAEWSLRATNALLEHGIVEPRSVASDDI
HIAVLTQCLNDTPMFRSITRVIMEDCQAHNDPHVTRQAPSSDAALIALRIISRAIVLHPA
LRSCARVTSSDILVASIPSLIFCPIISASQCTLLDLVFHYLHMADDYPVHSLYAARILRD
VMATRGAVETKMLEILRTRKSAPSHVRAIRIAICSNSIQYTIDDSLSKEEDTDNPHFARG
ETARLVLETLSEAIDSHVTRCRNRVTDTNNICYYLLAFRPSYANTKELYKTDDSFTGLHY
VLHIIEQFVKSKQPFNLPFSALLEPAFRLMQRLVSISCPFSQPVLCFMRSSNIIEQLTTS
PFICSALTLENARDNTYAQGIFAVRRMIVGYILHFSAVEISAMLTTGHYTRPEKLYRALL
ESSSLVAEYTQDDLEEDVNTTLASRASGSKDHPNLLFSLLRRATVPRKNELVYPNLVHFD
VAKLHELFDACLTTNIYGVAQYDVLYLNRLMRREIDAVYTDSSEMKYVQKELESVLEYCT
EVNASLLSESASERIVSGCTALLNVFSVFAPVNFFSNRMQLVIFRDACYVLIEMCSGVGG
ASLVSACQTFHRLVLTVTKLAQVEYPKLLAQRRFFAPLFKSMIELFLQPGEKCVEAKVQL
YKTMRFILRTLFEKNSVDIVNIAEEWLLDGRMKAPTMLSDDEIVNIVDKMGDEIARHLES
NISDFPKHRKAAIVMLTSDLLHEDLKSNKKICNHFSKSGVPRILCDELLAISFDWNIVTS
VDKAKRVAGVSMAEHISNYKLFVSILTCFTRYAFSESGWIVLSELAVIEILAEMPAFIEP
PKDLFLKPETVKTKGTAANGYAKVLDLALHFCEQMCSKTKWKKQSYKILLFIQRLGEVFQ
QLMRAEIQCECLETAKAIVYEISLNDEALVGIIDGDQVLRALKQAEEAKEVKSNARQKYI
NVNTTFGAPRQLYSTLQPF
NT seq 5100 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggatattcgtgattttcacgaatatgtaaccacattcactgatttcgacgac
gatgacaagctgtctcagcttctcgttcgactggaacaatataaatggcgaatgataaat
cttctctcaaacccgaagaggacacctgaagaaaaagcgaaagcacagaatgagaagttg
gaagtcgaaggggtggagctctcacgattcgagcagctatctgaggaagcgaaaattctt
tccgatgtttttgagctgagagtcaatgaagcgtgcgacttgatcttagcgggagaagct
caaaaaatgcatttcgaaggtctgaaccgaggactttgtgcggtcgtttgctattatgat
gctcacagactcttagccgccgttgttcgtcaaatgttgaaatgggatcgagaggatgtt
ccatcgcaagtcaccgaattcctagatggtgcattcatccatgagaatatgataaaaatg
ctgtttcaaagattgaacacttttaacgtccagtccgttttcgctcttctccagaatcca
gaagtcaacggtttgggcggctcaaagcatcagaagctgttgagaaatgtgattgaagag
acccgaacagaaatcattcaatgcatctcgtcaatttgcgaatttcccggatcacatgca
gttcacatctcgaattatctcttccaactcgttaaggctgctcctccagagaaattgagt
gttggcaatttgaccgcatgggtttccctcatcaaacttacatctagcgaagtattgtca
caagtgcctgacgctacacaagtgttgaccagtatgatcgggcacattcgaaatgagacg
gactgggcagatcaagcactatgtggaactctccagcttgcttgtgcagtttctctaaag
tctatagcctcttcaccctctgatcatttgggaatcgaaaatatcaaagtagatgtggaa
agagtcattgatcgagctattcgaaatatggctttccattatcttcgacaagctatcatc
aagtcggagcatttccggttcgcccatcagttcattatcattgatgagcttctgaaacaa
ctggtctcatattttcccgcaaagttgatggaaactgaacgcaattcgacagatgaactc
aattttctcgacgaccagaaggaagccgcgacgcctgcatctacaaagaagccagatcca
aggaatcaaactgtgaatttgaatgacaaggttactgcacagctttcgactacggacccc
acgaataactacgactcggcgttgtcgaattatgagaatttcctgcgctgttttgtggat
ttgtatgagatgcaagttacagattacgttcatcagcgaatgccaaaaacgtatcgtgaa
agagaacttcaggaacaaattgaagagagcagcatgtcgttcagtactgaaagatcgatc
gagctttgccgtctcttggagcgtgcacgtattccaaatcatcatgtcgttcattcagtt
gcttaccttgaattgtgtgctgctgtttgtaagaatcaactcactgcgggacttctcttc
gatattttctcaagagaactctctggaccagacacctatggttgggaatcattgaccggt
gctctaaagggatacgacaggctgtacagagaacagaaatcagtaaccaactctcgtttc
aatcagaatcagacagttaacatgagcacaagcttccaacaaagtcagaacaaccagagt
ctaaatatcaaccttcgacccggagacaagatcaaaatcccagcgcaggagcttagtggg
cttgtagcctggctccgaatggccacaaaagttgctcagtttaacgagagagctgctaca
agattttccgacgatccatcgtggacaatgtgcgctgctgcagcatcattatctacatca
tctgtgccgctggctttgaaagctgcactgattgacttgctgacttctgtggctcgattg
aaacagactgcaccgagaatttggcacgttatacatcagaaccaactatgctacgtcgaa
ggagatcgattgagaggattgcaagaagaattggaaatgagagaatgtattgagaagcag
tatgatgtttcgctagcctttgtaaaactcatgacaactcttcttatgcatcgatctctt
ccggaatatgccactccatttattaaatttgtgacacaaagtattctgggacacttcctc
ttccgtagctacaacaatgttgttcaaatgtgggagctcgctgaatggtcgttacgtgct
actaatgcccttcttgagcacggaatcgtggaacctagatcagtggcttcggatgacatt
catatcgcagtgctgacccagtgtctcaacgatactccaatgttcagatcgatcacaaga
gtcattatggaggattgccaagctcacaacgacccacatgttactcgtcaagctccatca
tccgacgctgcattgatcgcactgcgaatcatttctcgtgcgattgttcttcatccagct
ctacgttcctgcgcacgtgtgacatctagcgacatactcgttgcttctataccatcactc
atcttctgcccaatcatctcagcttctcaatgcacacttttggatctcgtcttccattat
cttcatatggctgatgattatccagttcattcattgtatgctgctagaatcttgcgagac
gtgatggctactcgaggagccgtggaaacgaaaatgctggaaatactgcgaacaagaaag
tcagcaccctctcatgttagggctattcgaatcgcgatttgttccaattccattcagtat
acaattgatgattcgttgtcgaaagaagaagacactgacaatccacacttcgccaggggc
gaaactgctcgactagttctcgaaactctttcggaagctatcgacagtcatgtcactaga
tgccggaatcgtgttacggatacaaacaatatctgctactaccttcttgcattccgtcca
tcatacgctaatacaaaagagctctacaagaccgacgactcgttcacaggccttcactat
gtgcttcatatcatcgagcagttcgtcaaatcgaaacaaccattcaatttgccattttct
gcacttctggagcctgcgttccgactaatgcaacgtttagtctcgatatcttgtccattc
tctcaaccagtattatgtttcatgagatcttcaaacatcatcgaacaactaacaacatct
ccattcatctgctctgctctcacactagaaaacgcaagagacaacacttatgcacaagga
atcttcgcagttcgtcgtatgatcgttggatacatcctccacttctctgctgtcgaaatt
tctgcaatgctcaccactggacactacacccgtcccgagaaactctaccgtgctcttctg
gagtcttcatctcttgttgccgaatacactcaagatgatctcgaagaagatgtgaacaca
acgctcgcttcaagagcatcgggaagcaaagatcatccgaacttgctcttctcgctgctt
cgacgagctacagtaccacgaaagaacgagctggtttatccgaatttggtgcatttcgat
gtggcaaaacttcacgagttgttcgatgcctgccttactacaaatatttacggagtcgct
cagtacgatgttctatatctgaatcgtctgatgcgccgagaaattgatgcagtttacaca
gattcgtcagaaatgaaatacgttcaaaaggagcttgaaagtgtcttagagtactgcaca
gaagtcaacgcaagtctcttatcggaaagtgccagcgaacgaatcgtatctggatgtaca
gctcttctcaacgtcttctctgtgttcgctcctgtgaatttcttctccaaccggatgcag
ctcgtcatcttccgagacgcatgctatgtgctgattgaaatgtgctctggagtcggtgga
gcatcgctagtttctgcttgccaaaccttccatcgtcttgttctgacagttacgaaactc
gctcaagtggagtatccaaagcttctcgctcaacgacgattcttcgctcctctcttcaaa
tccatgatcgaactgttcttgcagccaggagaaaagtgtgtggaagcaaaggttcaacta
tacaaaacgatgagattcattcttcggaccctcttcgagaagaatagcgtagatattgtt
aacattgccgaggaatggttactcgatggacgaatgaaggctccaactatgctttctgac
gatgaaattgtgaatattgtggacaaaatgggtgatgagatagcacgtcatctggaaagc
aacatctccgatttcccgaagcatcgaaaggcagcaatcgtgatgttgaccagtgatctc
ctgcacgaggatttgaagagtaacaagaagatttgtaatcatttctcgaaaagtggtgtt
cctcggattttgtgtgacgagcttctggctatctcattcgactggaacattgtgacatct
gtcgacaaagcgaaacgagtcgcaggagttagtatggcggagcacatttccaactacaaa
cttttcgtctcgattctaacttgtttcacacgatacgccttctccgaatctggatggata
gttctttctgagttggcagttattgagattctagccgagatgcccgcattcatagaacca
ccaaaagatcttttcctgaaaccggaaactgttaaaacaaaaggaacagctgcaaatgga
tacgcgaaagtcttagatttggcacttcacttctgcgagcaaatgtgttctaaaaccaaa
tggaagaagcaatcctacaaaattctcctcttcattcaacgtctcggtgaagtgttccag
cagctgatgcgagctgaaatacagtgtgaatgtctggaaactgccaaagcgattgtttat
gaaatatctcttaatgacgaagctttggtcggtatcattgatggcgatcaagtccttcgt
gcactgaagcaagccgaagaagcgaaggaggtgaaatcgaatgcccgtcagaaatatatc
aacgttaacacgacattcggtgctcctcgtcaactctactccacactgcagccattctaa

DBGET integrated database retrieval system