KEGG   Caenorhabditis briggsae: CBG02827Help
Entry
CBG02827          CDS       T01054                                 

Gene name
Cbr-ace-4
Definition
C. briggsae CBR-ACE-4 protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBG02827 (Cbr-ace-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     CBG02827 (Cbr-ace-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 604 aa AA seqDB search
MKPKLVFLPFLIFITVFIEESEAVHPVVLETKLGDIRGNEFFFLSKKIRTFFGVPFAEPP
VEEFRFRKPREKKQWKKLFDATKPANACFQTRDNYNTSFWGSEMWNANTQISEDCLYLNI
WAPADAYNLTVMVWFFGGGFYSGSPSLSIYDGRALAATQHVIVVNINYRLGPFGFLYLDH
PDAPGNMGLLDQQLALHWIRQNIVSFGGNPDKVQFFGQSAGAASIVAHLIAPGSRGLFKN
AILQSGSLENTWAINSPFRAKQKSEKLLELVGCNKTTVENSMSCLRLVSPEQLSLSTWNI
SLTYLEFPFVIVSRDKHFFGHLDARAALREGDFNRDVNLMIGMNKDEGNYWNIYQLPQFF
DKAEPPELTRHQFDNLIDSTFSIQPDIIRSAAKYIYSDPNCTDHGRKTRFYAGQMNQIVG
DYFFSCDSLWLADQFFLFLQICSTPNGSLKNPPKVFVYYFTQSSSANPWPKWTGAMHGYE
IEYVFGVPLSYSKIYKRREQIFSRKIMQFWASFAKNGTPRLRVLKNSEHWPEFNEHNNYR
WMQLRSGSNIRPIKRRKETECQFWRRVKDTEYTAYLTQEYSSSCHINSYRILLFIPFFFI
FSAF
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaaacttgtgttcttgccatttctcatttttataactgtttttatcgaggaa
tcagaagccgttcatccggttgttctggaaacgaaactaggcgatattcgaggcaacgag
tttttctttttatcaaaaaagattcggacgttctttggagtaccattcgctgagccccca
gtcgaagaattccgattccgaaagccgcgagaaaagaagcaatggaagaaactattcgat
gcgacgaaaccggcaaacgcctgttttcaaacgagagataactacaacacgagtttctgg
ggaagcgaaatgtggaatgcaaatactcaaatcagcgaagactgcctttatctgaatatt
tgggctccggctgatgcgtacaacctgacagtaatggtatggttttttggtggtggattc
tattcaggaagtccttcattgagcatttacgatggaagggccctggctgcgacccaacat
gtaatcgttgtaaatatcaactaccgtctcggaccatttggattcctttatttagaccac
ccagatgcacctggaaatatgggacttttggaccagcaattggcgcttcattggattcgt
caaaatattgtgtcgtttggcggaaatccggacaaggttcagtttttcggccagtccgct
ggtgctgcctcaatcgtcgctcatctgattgctcccggctcccgaggacttttcaagaac
gcaattcttcagtcgggaagtcttgagaacacctgggccataaactctccttttcgagca
aagcaaaagtcagaaaagctgttggaacttgttggttgcaataagactacggtggaaaac
tcaatgtcctgcttacgattggtttcccctgagcaattgagtctgagcacatggaatatc
tcgttgacctatctcgaatttccgttcgtcattgtctccagagacaagcacttctttggt
catctagacgcgcgtgcggcgttgcgtgaaggcgatttcaatagggatgtgaacttgatg
attgggatgaacaaggacgaaggcaactattggaatatctatcagttgccccaattcttt
gacaaggccgaacctccagaattgaccaggcatcaattcgacaatctaatcgattcaacg
ttttcgattcaacctgacatcatccgttcagctgcaaaatacatttattcggacccgaat
tgcacggaccacggaaggaagactcggttctatgcaggccaaatgaatcaaatcgtcgga
gattatttcttttcgtgtgactcactttggttagccgatcagttcttcctttttctccag
atttgttcaactccaaatggttctttgaaaaatccaccaaaggtttttgtctactatttt
acgcagtcttccagtgccaacccatggccaaaatggactggcgcaatgcatggatacgaa
attgaatatgtttttggagttccgttgagttattcgaaaatttataaacgacgcgagcag
atattttcgagaaaaatcatgcagttttgggcgagttttgcgaagaatggaactccaaga
ctgcgggttctcaaaaatagtgaacattggccagagttcaatgagcacaataactatcga
tggatgcaacttcgaagtggctccaacattcgacctatcaaacgaaggaaagaaacagag
tgtcaattctggagaagagtcaaagatacggagtacactgcatacttgacccaggaatat
tcatcgagctgtcacataaactcctatcggattctactctttattccattctttttcata
ttctctgctttttaa

DBGET integrated database retrieval system