KEGG   Caenorhabditis briggsae: CBG02845Help
Entry
CBG02845          CDS       T01054                                 

Definition
Hypothetical protein CBG02845
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cbr  Caenorhabditis briggsae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CBG02845
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CBG02845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 312 aa AA seqDB search
MSSDRIVVLGSIVQDLVSYTDRFPRPGESVRGNDFKSGSGGKGANQAVAAARLGANVAMI
GLVGEDMFGDSNIKGLTENGVDTSCVGKTKESHTATATITVNKEAENSIVVTLGANLFLT
PEVADANSSIISNSKMVMCQGEIDEKGNRRAFEIARKNKVITFLNPAPGDANMDKTILDL
VDIICTNENEAEFITGIPQNNVEDAKKAAVEMVKMGPQHAIITLGAKGVLLASKGHNEIE
HISVDNVEAIDTTGAGDCFCGTFAAHHVAGVSMIDSIRSAAKIAALSVTRHGTQSSYWKL
DEIKEKHADFLP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgaccgaattgtagtgcttggaagtatcgttcaggatcttgtcagctacacc
gatcgtttcccacgtcctggagagtctgttcgtggaaatgatttcaagtcagggtccggt
ggaaaaggagcaaatcaggcggtagctgccgcgcgtcttggagccaatgtggcaatgatt
ggattggttggagaggatatgtttggagattcgaatattaaagggttgactgagaatgga
gtggatacgagttgtgttggaaagacaaaagagtcacacacggctactgcaactatcact
gttaataaagaagctgagaatagtatcgtcgtcactttgggagccaatttgttcctgact
ccagaagtagctgatgccaattcctcaattatttccaactcgaaaatggtcatgtgccaa
ggagaaatcgatgaaaaaggaaatagaagagcattcgaaatcgctcgaaaaaataaggtc
ataacatttttgaacccagctccaggagatgcaaatatggataaaacaattctggatctt
gtggatattatttgtacaaatgagaatgaggctgaattcatcactggaatccctcaaaac
aacgtggaagacgctaaaaaggctgctgtggaaatggtcaaaatgggtcctcagcatgcg
atcataacacttggagctaaaggtgttctcctcgcatcaaaaggccataacgagattgag
catatatcggtggataacgtggaagcgattgataccactggagccggtgactgtttctgt
ggtacatttgctgctcatcacgtcgctggagtttcaatgatcgattcgattcgttcggct
gcaaaaatcgctgctctctctgtgactcgacatggaacccaatcgagctattggaaatta
gatgagatcaaagagaaacatgcagactttttgccataa

DBGET integrated database retrieval system