KEGG   Caenorhabditis briggsae: CBG02847Help
Entry
CBG02847          CDS       T01054                                 

Definition
Hypothetical protein CBG02847
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG02847
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG02847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 1130 aa AA seqDB search
MRKSDEGGGSGRLSSSCSSIRSSNYSRSYTPSFNTFKYSPSSYTPNISRNLNSTASGSTA
ADSSSHTLPSSAPRSRLSFTTPSATSTNLSRNVSASHKTLYSSPAAARVSVSTNDSLSHS
TITPHNYRGISKYSIIERSTVGETKPYSSSYGTSSLSSSSYDRRSSRSDRISSSTLPEVK
IESGPTTRTHMVHPTSSHIRSRSSYGRTNTVAMFAQQARERAERDEKDRDYKEWMQREKD
RESELGLESLHITSAAPSTAQTDFRRAVAPNATSSSSATPYRSRYSSVTRVTSSATPTSS
AVAPMDDVMTTSYSSVAATPPPAYSQLSTSTSTLLRTRRERLDREDESRSSMTPQPSSFT
TSTIPPPPPPPPPTKGGYLPRSASAAVMSSYKPTAKVSPYEDDRDSVCIVDQGYTGLRNI
GNTCFMNAILQMLVNNVELREFFLRDHYKMEINESNPLGSEGRLARAFADFMVQMWNGRH
KAIEPVHIKNIVSEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKKKPLTGTVESHGRH
DLDVSNEAWRNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFPKNKKS
TSLYFWPVENQAKPFKLTVSYSAEGTVADFLSAVSEMIKVPTRNLRACEALCHRFDKIYT
SDMKVSDIISPDYLFVFQTHDETECNEEVVVLNVLQRELYRSNLKYSCHECGNSKVKLKA
CEECYDAVYCSKECQVANWSTGGHREVCSKRMSSDLVGHPLIVSLPRSQLTYQHLYRVLE
AKSRHTVTLFQQPQYDGEGVEGDSMQAPSGSTKKKNGVGAPPTFLQPPGESSSASSVSST
PRRRSVAAEPRSKNQKMFEIRKLANQNDSFGAHSIGDDDACQALESGSFVSINWINQRNG
KPYITIDNRTEIDTDVDKTKLMTVRGMGTLDKGHNSERSPHLTQMLSLFSETERLKPEES
WYCSTCKEHVEATKRLQLYRLPPVLIIQLKRFVYTAFTHQTSVHRRSKDDRTVEYPLESL
DMSPFLSETSPSHNSTMYDLTGVVCHSGSSYFGHYISLGRLADFDSSKTKIEWRKFDDSM
VDRVPSGHVQTNEAYLLFYKLRDPAATRCIFKRHYSCDPGASSQSAEVKI
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaagcgatgaaggtggtggaagtgggcgattgtcgagctcatgctcatcaatt
cgtagttccaattattcaagatcctacacaccaagcttcaacaccttcaaatactcacca
tcttcgtacacacccaacatctctcgtaatctgaattccacggcatctgggtcgacggcg
gccgactcgtcgtcgcatacattgccgtcgtcggccccccgatcgcgtctttcattcacc
acgccttccgcaacttcaacaaacttatcgcgaaacgtttccgcatctcacaagactctg
tacagtagtccagctgccgcaagagtctctgtctctacaaatgacagtctatctcattcg
acaattacaccacataattatcgagggatctccaaatatagcataattgaacgatccaca
gttggagaaacaaaaccatattcgtcgtcgtatggaacgtcatcattgtcatcgagttca
tatgatcggaggtcttcaaggagtgacagaatatcatcatcgactctcccagaagtgaaa
attgaatcgggaccaacgacaagaactcatatggtacatccaacgtcgtcacatatcaga
agtcgttcatcatatggtcgtacaaacacagttgccatgttcgcccagcaagccagagaa
cgtgcagaaagagacgaaaaagatcgagattacaaggaatggatgcaaagagaaaaggat
cgagaatctgaactcggtctcgaatctcttcatatcaccagtgcagcaccttcgactgct
caaaccgacttcagaagagcggtggcaccgaacgccacctcatcatcatctgcgacgccc
taccgatctagatattcttcagtgacacgtgtcacgtcttctgccacaccaacgtcttct
gctgtagctccgatggatgatgttatgacgacttcttattcaagtgttgcagctacacct
ccaccagcgtattcccagttatccacgtctacatcaactctactgagaactcgaagagaa
agattggatagagaagatgagagtcgaagctcaatgacacctcagccatcatcgtttact
acttcaactatccctcctccccctcctccacctccaccaacaaaaggaggatatctacct
agaagtgcttcagctgcagtcatgtcttcatacaaaccaactgcaaaagtgtctccatat
gaagatgatagagacagcgtttgtattgtggaccaaggatacacgggtcttcggaatatt
ggaaacacatgtttcatgaatgctatcctccagatgctcgttaacaatgtggaactacga
gaattcttcctgcgagatcattataaaatggagatcaacgaatcgaatccacttggttca
gaaggacgattggcacgagcattcgcagattttatggttcaaatgtggaatggaagacat
aaagccattgaacccgttcatattaaaaatattgtttctgagaaagcatcacaattcgcg
aactttgcacaacacgatgcacacgaattcctttcgtttcttctcgatggacttcatgaa
gacgtgaatcgggtgaagaaaaagccgttgacaggaactgttgaatcacatggaagacat
gatttggatgtgtcaaatgaagcatggagaaatcatattctcaggaatgactcgattttt
gtggatttgttccatgggcaattgaaaagtcatgtacagtgtccgaattgtgatcgggta
tccatcacatttgatccgttcgtctatttgcctgttcccttcccaaaaaacaagaaatcc
acgtcactatatttctggccagtagaaaatcaagcgaaaccgttcaaattgaccgtcagc
tactcagccgaaggaactgtcgctgatttcctttccgcagtcagtgaaatgatcaaagtt
ccaacaagaaacctccgagcgtgtgaagctctgtgtcatcgattcgataaaatttacact
agtgatatgaaggtgtcggacattatctcaccggattatctattcgttttccaaactcat
gatgaaacggagtgcaatgaagaagtcgtggttttgaatgttcttcaacgagaactatac
aggtcaaatctcaaatattcctgtcatgaatgtggaaactcgaaggtgaaactgaaggcg
tgcgaagaatgttacgacgctgtctactgttcgaaagaatgtcaagttgccaactggtca
actggaggacacagggaagtctgctccaagagaatgtcgagtgacctggttggacatcca
ttgatcgtttctctaccccgatctcaactgacttatcaacatctttatcgagttcttgaa
gcaaaaagtcgccatactgtaactctattccaacaaccacaatatgatggagaaggagtt
gaaggggactcaatgcaggctccatccggttcaacgaagaaaaaaaatggagtcggagca
ccaccaacattccttcaaccacctggagaatcatcttccgcttcaagtgtttcatcgact
ccacgtagaagaagtgtagctgcagagccccgttccaaaaatcagaagatgtttgaaatt
cgaaaattggcaaaccaaaatgattcattcggagcacacagtattggagatgacgatgcg
tgtcaagcattagaatctggaagttttgtatcgataaattggataaatcaaaggaatgga
aaaccgtacatcacaattgacaataggactgaaatcgatacggatgtggataaaacaaaa
ttgatgactgtcagagggatgggaaccctggataagggacataattctgaaagaagtcct
catctgacccaaatgctcagtttgttctcagaaactgaacgattgaaaccagaagaaagt
tggtactgttcgacatgcaaagaacacgtggaagctacaaaaaggctgcaattgtatagg
ttgccaccagttttgatcattcagttaaagagatttgtgtacacagcattcactcatcaa
acgtctgtgcatcgaagaagcaaagatgaccgaactgttgagtatccattagagagtttg
gatatgtctccgttcctctctgaaacgtctccaagtcataattcgacgatgtacgatcta
accggagttgtctgtcacagtggaagcagttatttcggtcactacatcagtttgggacgt
ctcgctgatttcgattcttccaaaacgaaaatcgaatggaggaaatttgatgattcgatg
gttgatcgagtgccatctggacatgtacaaaccaatgaggcttacctcttgttctataaa
ttaagagatccagcagcaacacgatgcattttcaagcgtcactattcctgcgatcctggt
gcatcttcacaatcagcggaagtcaaaatttag

DBGET integrated database retrieval system