KEGG   Caenorhabditis briggsae: CBG02850Help
Entry
CBG02850          CDS       T01054                                 

Definition
Hypothetical protein CBG02850
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cbr00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 712 aa AA seqDB search
MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIESPHSKVALLRK
AGKVSVLSDFIKESADDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVV
HNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHIHDRYPDFSFRQLVETVIQQLEG
AFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDE
SSFVETPNNILDLSIAVRSSNGSAKLEISDSTTAVRPFDSADWEVEYFVASDAAAIIEHT
KQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVQLLEMELQEIMKGSYKTYMQKEI
FEQPDSVVNTMRGRLLPSRQVVLGGIKEYLPDIKRCRRLIMVACGTSFHSAIACRQILEE
LSELPVVVELASDFLDRETPIFRDDVCLFISQSGETADTLMALRYCKPRGALTIGVTNTV
GSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMATRREEIIDAL
NDLPNLIREVLKLDDKVHEIAQQIYKEKSLLIMGRGFNFATCLEGALKIKELSYMHCEGI
MSGELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADNSVPEGDLA
GMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcgcttacctcaacttcctcacaccgaagaagcgttcggaaattgtg
gacattttggttcaaggactgcaaagaatggaatacagaggatacgactccgctggtatc
gccatcgatggatccaatgacatcgagtcgcctcattcgaaggttgcattgcttcggaaa
gctggaaaggtgtcagtcttgagcgatttcatcaaggagagtgctgatgaccttgacatg
gatatggagtacaacatccattgtggtattgcacacacccgttgggccacccacggatca
ccacgtgatgtcaactctcacccacatcgtagcaacgacaagaatgagttcctcgtcgtt
cacaacggaatcatcacaaactaccgcgagatcaaggagtacctcgagaagaagggacac
aagtttgaatccgagaccgatactgaagtcatcgccaaactcacacagcacatccatgat
cgctaccccgacttctcgttccgtcagttggtcgagactgttatccagcagttggaagga
gcattcgcattggccttcaagtcgtctcgcttcccaggacaacttgttgcttctagacgt
ggttctccacttctcgtcggaattaagagcaactcgagactccagaccaaccacttccca
gtctctttctccaaaggtcgccggttcatgtcaaaccatgctacccacttgcgagatgag
tcatcattcgtcgagacgccaaacaacatcctggacctttcgattgctgtcagatcgtcg
aatggatccgccaagctagagatatccgacagcaccacagccgtccgcccattcgattct
gctgattgggaagtcgaatacttcgttgcttctgatgccgccgccatcatcgagcacacc
aaacaagttctcttccttgaggatgacgacgttgcattcgttgaggatggagcactcact
atccaccgtatctcccgtcacgccgacaatggagagcaaaagagagaagttcaactcctc
gagatggagctccaagagatcatgaagggatcctacaagacctacatgcaaaaggaaatc
ttcgagcagccagattcggtcgtcaacacgatgcgtgggcgtctccttccatcaagacaa
gtcgttctcggtggaatcaaggagtaccttccggacatcaagcgttgtcgtcgtctcatc
atggttgcatgtggaacatctttccactccgccattgcttgccgtcaaatccttgaggaa
ctttcggagttgccagttgttgttgagctcgcctccgacttcctggaccgtgaaacacca
atcttccgtgacgatgtctgcctcttcatatcccagagtggagagactgccgatactctc
atggctttgagatactgtaagccacgtggagctctcactattggagtaactaacacggtc
ggatcatccatctgtcgtgagtctcactgcggaatccacatcaacgctggaccagaaatc
ggagtcgcttctactaaagcttacacctcccagattctctcgcttctaatgttcgctctc
actttgtccgatgatcgcatttcaatggccactagacgtgaagagattatcgatgcactc
aacgatcttccaaacttgatccgcgaagttctcaagctcgacgacaaggtccatgagatc
gctcaacagatctacaaggagaagtcgcttctcatcatgggacgtggattcaactttgcc
acatgcctcgaaggagcactcaaaatcaaggaactttcgtacatgcattgcgaaggaatc
atgtctggtgaactcaaacacggaccacttgccatggttgatgagttccttagcatctgt
atggttgtatgcaatgatcatgtctacaagaaatcgttgaacgctctccaacaagtcgtt
gcccgcaaaggagctccaatcatcatcgcggacaactctgttccagagggagatcttgca
ggaatgaagcatattcttcgcgttccaaagaccgtcgattgtgtgcagaacatccttacc
gtcatcccactccaacttttgtcctaccacatcgccgagctcaatggtgctaatgttgac
cgaccccgcaatttggccaaatccgtgacagtcgaataa

DBGET integrated database retrieval system