KEGG   Caenorhabditis briggsae: CBG02850Help
Entry
CBG02850          CDS       T01054                                 

Definition
Hypothetical protein CBG02850
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBG02850
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG02850
Enzymes [BR:cbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     CBG02850
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C44
   CBG02850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 712 aa AA seqDB search
MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIESPHSKVALLRK
AGKVSVLSDFIKESADDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVV
HNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHIHDRYPDFSFRQLVETVIQQLEG
AFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDE
SSFVETPNNILDLSIAVRSSNGSAKLEISDSTTAVRPFDSADWEVEYFVASDAAAIIEHT
KQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVQLLEMELQEIMKGSYKTYMQKEI
FEQPDSVVNTMRGRLLPSRQVVLGGIKEYLPDIKRCRRLIMVACGTSFHSAIACRQILEE
LSELPVVVELASDFLDRETPIFRDDVCLFISQSGETADTLMALRYCKPRGALTIGVTNTV
GSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMATRREEIIDAL
NDLPNLIREVLKLDDKVHEIAQQIYKEKSLLIMGRGFNFATCLEGALKIKELSYMHCEGI
MSGELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADNSVPEGDLA
GMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcgcttacctcaacttcctcacaccgaagaagcgttcggaaattgtg
gacattttggttcaaggactgcaaagaatggaatacagaggatacgactccgctggtatc
gccatcgatggatccaatgacatcgagtcgcctcattcgaaggttgcattgcttcggaaa
gctggaaaggtgtcagtcttgagcgatttcatcaaggagagtgctgatgaccttgacatg
gatatggagtacaacatccattgtggtattgcacacacccgttgggccacccacggatca
ccacgtgatgtcaactctcacccacatcgtagcaacgacaagaatgagttcctcgtcgtt
cacaacggaatcatcacaaactaccgcgagatcaaggagtacctcgagaagaagggacac
aagtttgaatccgagaccgatactgaagtcatcgccaaactcacacagcacatccatgat
cgctaccccgacttctcgttccgtcagttggtcgagactgttatccagcagttggaagga
gcattcgcattggccttcaagtcgtctcgcttcccaggacaacttgttgcttctagacgt
ggttctccacttctcgtcggaattaagagcaactcgagactccagaccaaccacttccca
gtctctttctccaaaggtcgccggttcatgtcaaaccatgctacccacttgcgagatgag
tcatcattcgtcgagacgccaaacaacatcctggacctttcgattgctgtcagatcgtcg
aatggatccgccaagctagagatatccgacagcaccacagccgtccgcccattcgattct
gctgattgggaagtcgaatacttcgttgcttctgatgccgccgccatcatcgagcacacc
aaacaagttctcttccttgaggatgacgacgttgcattcgttgaggatggagcactcact
atccaccgtatctcccgtcacgccgacaatggagagcaaaagagagaagttcaactcctc
gagatggagctccaagagatcatgaagggatcctacaagacctacatgcaaaaggaaatc
ttcgagcagccagattcggtcgtcaacacgatgcgtgggcgtctccttccatcaagacaa
gtcgttctcggtggaatcaaggagtaccttccggacatcaagcgttgtcgtcgtctcatc
atggttgcatgtggaacatctttccactccgccattgcttgccgtcaaatccttgaggaa
ctttcggagttgccagttgttgttgagctcgcctccgacttcctggaccgtgaaacacca
atcttccgtgacgatgtctgcctcttcatatcccagagtggagagactgccgatactctc
atggctttgagatactgtaagccacgtggagctctcactattggagtaactaacacggtc
ggatcatccatctgtcgtgagtctcactgcggaatccacatcaacgctggaccagaaatc
ggagtcgcttctactaaagcttacacctcccagattctctcgcttctaatgttcgctctc
actttgtccgatgatcgcatttcaatggccactagacgtgaagagattatcgatgcactc
aacgatcttccaaacttgatccgcgaagttctcaagctcgacgacaaggtccatgagatc
gctcaacagatctacaaggagaagtcgcttctcatcatgggacgtggattcaactttgcc
acatgcctcgaaggagcactcaaaatcaaggaactttcgtacatgcattgcgaaggaatc
atgtctggtgaactcaaacacggaccacttgccatggttgatgagttccttagcatctgt
atggttgtatgcaatgatcatgtctacaagaaatcgttgaacgctctccaacaagtcgtt
gcccgcaaaggagctccaatcatcatcgcggacaactctgttccagagggagatcttgca
ggaatgaagcatattcttcgcgttccaaagaccgtcgattgtgtgcagaacatccttacc
gtcatcccactccaacttttgtcctaccacatcgccgagctcaatggtgctaatgttgac
cgaccccgcaatttggccaaatccgtgacagtcgaataa

DBGET integrated database retrieval system