KEGG   Caenorhabditis briggsae: CBG02850Help
Entry
CBG02850          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG02850
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBG02850
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG02850
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    CBG02850
Enzymes [BR:cbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     CBG02850
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C44
   CBG02850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 712 aa AA seqDB search
MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIESPHSKVALLRK
AGKVSVLSDFIKESADDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVV
HNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHIHDRYPDFSFRQLVETVIQQLEG
AFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDE
SSFVETPNNILDLSIAVRSSNGSAKLEISDSTTAVRPFDSADWEVEYFVASDAAAIIEHT
KQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVQLLEMELQEIMKGSYKTYMQKEI
FEQPDSVVNTMRGRLLPSRQVVLGGIKEYLPDIKRCRRLIMVACGTSFHSAIACRQILEE
LSELPVVVELASDFLDRETPIFRDDVCLFISQSGETADTLMALRYCKPRGALTIGVTNTV
GSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMATRREEIIDAL
NDLPNLIREVLKLDDKVHEIAQQIYKEKSLLIMGRGFNFATCLEGALKIKELSYMHCEGI
MSGELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADNSVPEGDLA
GMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcgcttacctcaacttcctcacaccgaagaagcgttcggaaattgtg
gacattttggttcaaggactgcaaagaatggaatacagaggatacgactccgctggtatc
gccatcgatggatccaatgacatcgagtcgcctcattcgaaggttgcattgcttcggaaa
gctggaaaggtgtcagtcttgagcgatttcatcaaggagagtgctgatgaccttgacatg
gatatggagtacaacatccattgtggtattgcacacacccgttgggccacccacggatca
ccacgtgatgtcaactctcacccacatcgtagcaacgacaagaatgagttcctcgtcgtt
cacaacggaatcatcacaaactaccgcgagatcaaggagtacctcgagaagaagggacac
aagtttgaatccgagaccgatactgaagtcatcgccaaactcacacagcacatccatgat
cgctaccccgacttctcgttccgtcagttggtcgagactgttatccagcagttggaagga
gcattcgcattggccttcaagtcgtctcgcttcccaggacaacttgttgcttctagacgt
ggttctccacttctcgtcggaattaagagcaactcgagactccagaccaaccacttccca
gtctctttctccaaaggtcgccggttcatgtcaaaccatgctacccacttgcgagatgag
tcatcattcgtcgagacgccaaacaacatcctggacctttcgattgctgtcagatcgtcg
aatggatccgccaagctagagatatccgacagcaccacagccgtccgcccattcgattct
gctgattgggaagtcgaatacttcgttgcttctgatgccgccgccatcatcgagcacacc
aaacaagttctcttccttgaggatgacgacgttgcattcgttgaggatggagcactcact
atccaccgtatctcccgtcacgccgacaatggagagcaaaagagagaagttcaactcctc
gagatggagctccaagagatcatgaagggatcctacaagacctacatgcaaaaggaaatc
ttcgagcagccagattcggtcgtcaacacgatgcgtgggcgtctccttccatcaagacaa
gtcgttctcggtggaatcaaggagtaccttccggacatcaagcgttgtcgtcgtctcatc
atggttgcatgtggaacatctttccactccgccattgcttgccgtcaaatccttgaggaa
ctttcggagttgccagttgttgttgagctcgcctccgacttcctggaccgtgaaacacca
atcttccgtgacgatgtctgcctcttcatatcccagagtggagagactgccgatactctc
atggctttgagatactgtaagccacgtggagctctcactattggagtaactaacacggtc
ggatcatccatctgtcgtgagtctcactgcggaatccacatcaacgctggaccagaaatc
ggagtcgcttctactaaagcttacacctcccagattctctcgcttctaatgttcgctctc
actttgtccgatgatcgcatttcaatggccactagacgtgaagagattatcgatgcactc
aacgatcttccaaacttgatccgcgaagttctcaagctcgacgacaaggtccatgagatc
gctcaacagatctacaaggagaagtcgcttctcatcatgggacgtggattcaactttgcc
acatgcctcgaaggagcactcaaaatcaaggaactttcgtacatgcattgcgaaggaatc
atgtctggtgaactcaaacacggaccacttgccatggttgatgagttccttagcatctgt
atggttgtatgcaatgatcatgtctacaagaaatcgttgaacgctctccaacaagtcgtt
gcccgcaaaggagctccaatcatcatcgcggacaactctgttccagagggagatcttgca
ggaatgaagcatattcttcgcgttccaaagaccgtcgattgtgtgcagaacatccttacc
gtcatcccactccaacttttgtcctaccacatcgccgagctcaatggtgctaatgttgac
cgaccccgcaatttggccaaatccgtgacagtcgaataa

DBGET integrated database retrieval system