KEGG   Caenorhabditis briggsae: CBG02868Help
Entry
CBG02868          CDS       T01054                                 

Gene name
Cbr-age-1
Definition
C. briggsae CBR-AGE-1 protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG02868 (Cbr-age-1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    CBG02868 (Cbr-age-1)
   04630 Jak-STAT signaling pathway
    CBG02868 (Cbr-age-1)
   04068 FoxO signaling pathway
    CBG02868 (Cbr-age-1)
   04070 Phosphatidylinositol signaling system
    CBG02868 (Cbr-age-1)
   04150 mTOR signaling pathway
    CBG02868 (Cbr-age-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     CBG02868 (Cbr-age-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1397 aa AA seqDB search
MDFPFQAPIPPLTANYQSEPEKIGQATDMMIKRVTDAKKMIEELLQMLDLQEKCPWPDML
EKFSSLASAMASLQTSVRKSGLPHGHEDHGQFLRSHVLVPQRLQYEPDEALLRVTQGRVF
SWNHELVPEYLRTKPNPEMENEEQMLDMERSAKAPDLVVKQIAAYNKNIEGLLGSLSNID
RLHSEAIIEKPTHSREETMKLVKSILLGEAIRTLRTAGAPPTSTPMPAAPGSAGPSQSGS
QVMNQAPGMQDYQNPQLRQQLMGQPPQMGYGNAYPPQYPQMHPQQMGYCSFLLAVTATVF
RPSLETENGKGSLLLSSEGVADMIVLSSFGEVISVVFPWFLANVRTSFDIKLSEFKHQLF
EQIGPMKWGKHSTQPQDYAFRQLNNFGEIEVIFNDDQQLSCLELHGTFPMLFLFEPDGFN
RDKELMCDISHCLGYSLDKLEESIDEELRQFRASLWTQTKKTCFERGVDGVDHYAFPEEQ
YFCVGEKCPTDLESKVKAAKLDYQLFWTKRKSEANEVWEKMYKITIDFDPEFNPQSLMRM
FVKELQCMNLFDPEDPPDEEWILQLAGRTSFVTRPEISLVSYDGIRSELESYRCPGFVVR
RKSLVLKDYVRPKPLYEPHYVRVHERKMALDVLSVSIGTEVKHSGNSDKVWTDFRPTASL
EQITLWDLDSNLMIRPVNVTGLPFTASHDIYLGMEFKVYVGTLTLATIKIPRVPTTKLVW
KREFFTFDLYMKDMPPSAILSVRVYSMKTTKMKEEIELGWVNISLSDWRDELRQGQIKLN
LWGPEPSANRSRIGHNGAKIGTSLSVTVEISSHGRRVKMPNEAQYKYLVDHRISWSDTVE
IVGDDYEACIGDPGYKKLQDLVKKHESGVILDDSEQRHVWSWRNYIQKQEPDLLVVLSEL
RIVWTDRENFSELYVMLETWKAPSVAAALTLLGKRCTDRVIRKFAVNKLNDQLSQFNVHL
FLLPLIQALKYEPRAYSEVGMMLLTRALSSYRIGHRLFWLLRSEICRLKDCATNNEEYRR
ISLLMEAYLRGNEEHIKGIIRQVDMVDELTRISSLVKGLSKEAAREKLRDQLRTISHKME
SIDSPLDPVYKFGEMVIEKAIVLGSAKQPLRLVWKNKNPKSDLHLPFCEVIFKNGDDLRQ
DMLVLQVLEVMDTIWKAANIDCCLSPYGVLPMGEMIGIIEVVPNCKTIFEIQHKAGLVNT
AARSVDSNFMNKWIRKQCGFVDEKKKYKKGGGPTVDSAQATKKYFESVDRFLYSCVGYSV
ATYIMGIKDRHSDNLMLTEDGKYFHIDFGHILGHGKTKLGIQRDRQPFILTEQFLTIIRS
GKPVDGNSHEIQKFKTLCLEAYEVMWNNLKYKFQKTLCCKGETKEKARKFFAGVYEEAFN
GSWSTKTNWLFHAMKHY
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggatttcccattccaagctcccattccacctctcacagccaactatcaaagtgagccg
gaaaaaattggacaggcgacagatatgatgatcaaaagagtgacggacgccaagaaaatg
attgaggagcttctgcagatgttagatttacaagagaagtgcccgtggcctgatatgctc
gagaagttctcatcattagcatcggcaatggcaagtctgcagacgtcggtacggaaaagc
ggcttgccacacggtcacgaagatcatggacaattcctgcgatctcatgttctagtgccg
caaagattgcaatacgaaccagatgaagctcttctgagagtaacccaaggtcgggtcttt
tcatggaaccatgagttggtgccagaatatttgagaacgaagccaaatccagagatggaa
aatgaagaacagatgctggacatggaacgaagtgcaaaggctcctgatctcgttgtgaaa
cagatagctgcatacaacaaaaatatcgaaggactcttgggcagtttatcaaatatcgac
aggctgcacagtgaggccattatcgaaaagccaacacacagccgtgaggaaacaatgaaa
ttagtcaaatccatcttattaggagaagcaatccgaactttgcgaactgctggcgctcct
ccaacgtccacgcctatgccagctgcacccggctcagctggtccttctcaatcaggatca
caagtgatgaaccaggctccaggaatgcaagactatcagaacccacagctgcgtcagcag
ctcatgggacagccaccacaaatgggatatggaaacgcgtatccaccacagtatcctcaa
atgcatcctcaacaaatgggttactgtagttttcttctggcagtaaccgccaccgttttc
agaccgtctttggaaactgaaaatggcaaaggatccttgcttctatcgtccgaaggagtg
gctgatatgattgtattgtcttctttcggagaagtgatcagcgtcgtttttccatggttc
cttgcaaatgttcgaaccagttttgacatcaaactttcggaattcaaacaccaattgttc
gaacaaatcggtccaatgaaatggggaaaacactctacacaacctcaggattacgctttc
agacagttgaataacttcggggaaatcgaagttatatttaatgatgatcagcaactatct
tgtcttgaactacatggaacatttcctatgctctttctttttgaacctgatggattcaac
agagacaaagaactgatgtgcgatataagtcattgtcttgggtattcgcttgataagcta
gaggagagtatcgacgaagaacttcgtcaatttcgtgcttcattgtggactcaaaccaag
aagacttgttttgaacgtggagtggatggtgttgatcactacgcgtttcccgaagagcag
tatttctgtgtgggtgaaaaatgcccaacggatttggagtcaaaagtcaaagctgcaaag
ttggattatcaattgttctggactaaacgaaaatcggaagccaatgaagtttgggagaaa
atgtacaaaattacaatcgattttgatcctgaattcaatccacaatccctcatgagaatg
tttgttaaagaacttcaatgtatgaatttatttgatcctgaagatccaccagatgaagaa
tggattctacaattggcagggcgaacaagttttgtgactcgtccagaaatttcacttgtt
tcttacgatgggattcgctctgagctagaaagctaccgatgtccgggattcgttgttcgt
cgaaaatcattagttcttaaggactacgtacgcccgaaaccactctatgaacctcattat
gtgcgagttcatgaaagaaaaatggccctggatgtgttgagtgtttctattggaaccgaa
gtaaaacatagtgggaacagtgacaaagtgtggacagactttcgacctacagcctccctg
gagcaaataactctttgggaccttgattctaatcttatgattcgaccagtaaacgtaact
ggacttccgttcactgcctcccatgatatttatttgggaatggaattcaaggtctacgtc
ggaacattgaccctggccacaatcaaaattcctagagtccctacgacaaaattggtctgg
aaaagagaatttttcacattcgacttgtacatgaaggatatgccaccatcagctatatta
agtgttcgagtctattcaatgaagactacaaaaatgaaagaagaaattgaactcggatgg
gtgaacatttctctcagcgactggcgagatgaactacggcaaggacagataaaactgaac
ctctgggggccagaaccgtcagcgaacagaagtagaattggtcacaatggtgcgaaaata
ggaacatcgttgtcagtaaccgttgaaatatccagtcatggtcgacgagtgaaaatgcca
aatgaagcgcaatacaagtatcttgtggatcatcgaataagttggtcagacactgtagaa
attgttggcgacgattacgaggcatgtattggagatccaggatataagaagctgcaggat
ttggtgaaaaaacatgaatctggagtgattctagacgattctgagcaacgacatgtttgg
tcgtggagaaactatattcagaagcaggaacctgacttgttggttgttctttctgaacta
agaatcgtgtggacagatcgtgaaaacttttcggaactctatgtgatgcttgagacatgg
aaggctccaagtgtggctgctgcattgactctacttggaaaacgatgtactgatcgagtg
attcgaaagttcgctgttaacaagttgaatgatcaactcagccagttcaatgttcatctc
ttccttctcccactcattcaggcattgaaatacgaaccacgtgcttattcagaagttgga
atgatgttgttgacacgagcactcagcagttaccgtatcggacatagactattttggctg
cttcgttcagaaatttgtcgattgaaagactgtgcaacaaataacgaggaataccggcgt
atctctcttctgatggaggcatacctacgtggaaatgaggagcatattaagggtatcatc
cgtcaagtcgacatggttgacgaacttactcgtatcagttcactcgtgaaaggactatcc
aaagaagcggcccgggaaaaactccgtgatcagctgagaacaatcagtcacaaaatggaa
agcatcgattctccattggatccagtttacaaatttggggaaatggtaatcgaaaaagct
atcgttttgggaagtgccaagcaaccactacgacttgtttggaaaaataagaatcctaag
agtgaccttcatcttcccttctgcgaagtgatcttcaagaatggagatgatctcagacag
gatatgctcgttttgcaagtactagaagtaatggacacaatttggaaggcggctaacata
gactgttgtttgagtccatacggtgttttgccaatgggggaaatgattggaattatcgag
gtcgtgccaaactgcaaaaccatttttgaaatccaacacaaagctggcctagtgaataca
gccgctcgaagtgttgactccaattttatgaacaaatggattcggaaacagtgtggattt
gtagatgaaaagaagaaatacaaaaaaggtggtggtccaactgttgactctgcacaagcg
accaagaaatactttgaaagtgtagatcgattcctgtattcatgtgttggatactctgtt
gccacttatatcatgggtatcaaggatcgacacagtgataatttgatgttgactgaagac
ggaaaatatttccatatcgatttcggacacattcttggacacggaaaaacaaaattagga
attcagagagatcgtcagccattcattctcaccgaacaatttttgacgattattcgatct
ggaaagccggtcgacgggaattcacacgaaattcaaaaattcaagacactctgtctcgaa
gcctacgaagtcatgtggaacaatctaaaatacaaatttcagaaaacgctatgctgtaaa
ggcgaaacaaaggagaaggcgaggaagttcttcgctggagtctacgaagaagcattcaat
ggatcatggtccaccaaaactaattggctgttccatgccatgaaacactactaa

DBGET integrated database retrieval system