KEGG   Caenorhabditis briggsae: CBG03252Help
Entry
CBG03252          CDS       T01054                                 

Definition
Hypothetical protein CBG03252
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1471 aa AA seqDB search
MPVGESASSPLDGDTAPLNVSNNESGDEGPRKRSASPTANQSTWGDNPAKKICTEGIDLW
VQSTSEATAPDVSQTYQENHDMLVSMGFNSDEIDTALRMSNNEVEKAIQYLTREITGLDA
ASKPSSSVDKPQKQCYPLNEMLRSQFVESDEEDLADDMKLVWDEESFHRLRVILDNNHRY
VIFRQNGTLHRRMMVATNILRAKKNEKMAEVIHFVDEILYFVIGRHVNCSDVRPGFELLR
QLLELQPPYIGESDAHIIEQFYIAITPLLCARLMVPPSSVKTVLAIDEMFNYRNKFFIQG
VQFIDLEDREYPPLKYMDIDKLERIEHKRIYAYLTDVFVEALVPMMDDRFEVESDEEFFE
VTLLDLQCILRTLNIFSNYMCRNNDLFLCKLETWIEKALDRYRIVNDKEIRDALIRRQGL
DLLQEIVVLCERFNLDVATTTQRARLDYLRKWIKCPQMESILHALEELGTIADRFHRSGG
MTITRPKASVKEEFFKKWLEENKVLQIVLTGNMDHVVYVERIQPILQYMTPELTLDDMKF
IWSLRKGRMGVSVENFNKIMEFISKSVTDEQIEWLIELFKKSFRSRETRLYEPIFNFAYI
IAIQKERDDECKLKISKIMWELIFIARGPPRCMSFKSIEHGMRKHCDLMNLMFDKSERDA
FLGKVLDCLESDEQFNEIIVTYMYIMLEKLKRQFGSKRHIGTDDGSARANELRAQLRERR
IGDSMLSRLEHIRRVAHEQFDALQQVSQDSQSNAVFESTNDMFGGHHLENVLSTPIYGCT
DYAFILQHSLRLLKWLHDADATIVDVEYVERLFDIFIKRPDSSSQERTEIFGFLLEVKLL
MVRPETSRSIITHLCDMDMFTLQITGLRCFCKYWEELPILSNEEKEPIESFIFKKDNECK
LFVWKLILFNQFDDVVAKCMETFCERDLVLVDSPYSVRHHTYSFLAVFSFYVEKLKSELY
QRNGMPNTEIKYETEELALSDEEIEQYYVPLDDMLTETIVRALNRLVRFMTRFVELGNEK
NHMIRELPSHGSSVSGHPVTLNIELKNDDDDIDCGLNAWKTLVCDSSTTIGELKFRLAKR
LLFHEGMTDFTVHKREDDITMGEANLRYDFLTLQNVKVATETDSIFLSEKIRILVKPNSL
RKSSSRRSDSQIYQVNQKKALREDFLPITMISKCNFYDLLHELSSIGDKHIRASVRKLML
LLPTQPSLLMQLTFSDTNTEEQNAKITEMYEQYINPADPGRMLYALEAISSIIAPTRMTY
TAMTKASELINALQIKESFVIKKLVYEILAKPHVIPLNKCSSGDRHSIFERILQIVRTSF
TGRNAFIKTVKNELRVRDEMKKTCDRMIQSRQNPRPIDPPMEFALIRQQIVPPVGIDHQR
CPYLNTELDVFEFKMSFGTYMATIKASLNAWELADLIPFFERIRDFQWIHVATESLVVKQ
IDPFREKGAPQDPLSETASDLIRSVTRGERC
NT seq 4413 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcggtgaatcagcgagctcgccgctggacggtgacactgctcctctcaacgtc
tctaacaacgaatctggcgatgaggggcctagaaagagatccgctagcccaacagcaaac
cagtcaacatggggagataatccggctaagaaaatctgcacggagggaatcgacctgtgg
gttcaatcaacgagtgaggcgacagctcccgatgtgtcacagacgtatcaagaaaaccat
gatatgcttgtctcaatgggctttaattcggatgaaatcgacacagctttaagaatgtca
aacaacgaggttgaaaaagcaattcagtacttaactcgagagataactggtttggatgct
gcttcgaaaccgtcatcatctgtagataagccgcagaaacaatgttatcctttaaacgaa
atgctgagaagtcaatttgtggaaagtgacgaagaggatctggctgatgatatgaaatta
gtctgggacgaagaatcatttcatagactccgagtgattcttgacaacaaccatcgctat
gtgatattccggcaaaacggcacattacatcgaagaatgatggtagcaaccaatatcttg
cgagcgaagaaaaacgaaaagatggcggaagttattcatttcgtcgatgaaattttgtac
ttcgtcattggaagacatgtgaattgcagcgacgtcagacctggatttgagttactccga
cagcttctcgaactgcagccgccatatattggtgaaagtgatgcacatattatcgagcag
ttttacattgccataactcctcttctatgtgctcggctcatggttccgccgagcagcgtg
aaaactgtattggctatcgatgaaatgttcaactaccgtaacaaattcttcattcaaggg
gtgcaattcatcgatcttgaggatcgtgaatatcctccactgaaatacatggacatcgat
aaactggagaggattgagcacaaacgcatctatgcatatctcacagatgtgtttgtggag
gctctagttcccatgatggacgacagatttgaagtagaaagtgacgaagaattctttgaa
gttacgctgctagatctccaatgcattctcaggactttaaatatcttcagtaactatatg
tgccgaaataatgatttgttcctttgcaagttagaaacttggatcgagaaagctcttgat
cgctacagaatcgttaatgacaaggaaattcgtgatgcacttatacgcagacaaggactg
gatctccttcaagaaattgttgtgctctgtgaacgattcaatttagatgttgctacaacg
acacaacgagcaagactagattatctccgcaaatggatcaaatgtccacagatggaaagc
atattgcatgctctagaagaactcggaacaatagctgatcggtttcacagatcgggagga
atgactatcactcgtccgaaggctagcgtgaaggaggaatttttcaagaaatggctcgag
gaaaacaaggttctacagattgttttgactggaaatatggatcatgtagtatacgtggag
cgcattcaacccattctacaatatatgactcctgagttgactctggatgatatgaagttt
atttggtcgctcagaaaaggaaggatgggtgttagtgtggaaaattttaataagatcatg
gagttcatctcaaagtctgtaaccgacgagcaaatcgaatggcttatcgaacttttcaag
aagagttttcgaagtcgtgaaacgcgtctttacgagcctattttcaacttcgcctatatt
atcgccattcaaaaagagcgggacgatgagtgcaagttgaagatctccaaaataatgtgg
gagctgattttcattgcgagaggcccaccaagatgtatgtcgttcaaatcgatcgagcac
ggaatgaggaaacattgtgatctaatgaatcttatgtttgacaaatctgaaagagacgcc
ttcttgggaaaagtcctggactgtttggagtcagatgagcaattcaacgagatcattgtc
acatacatgtacatcatgcttgagaagttaaaacggcagtttggctcgaagagacacatc
ggcaccgatgacggatcggctagagcgaatgagctgagagctcaacttcgtgaacggcgt
ataggtgactccatgctgagtcgtttagaacacattcgtcgagtggcacatgagcagttc
gatgcgttgcagcaagtcagtcaagattcacagtccaacgcagtattcgagtccaccaat
gacatgtttggagggcatcatttagaaaacgttctttctacgcctatctatggatgcact
gactacgcattcatccttcaacactctcttcgtcttctaaaatggctccatgatgcggat
gcaactattgttgatgtcgaatatgtagaaagactgtttgatatcttcattaagcgccct
gattcatcatctcaagaaagaactgaaatcttcggatttcttctcgaggttaagttgttg
atggtgagacctgaaacatcacgatcaatcatcactcatttgtgtgacatggacatgttc
acattgcaaatcactgggttgcgttgcttctgcaaatattgggaagagctgccgatcttg
agcaacgaagagaaagaacccattgaatccttcatctttaagaaagataatgaatgtaag
ttgtttgtttggaaactgattctttttaatcagttcgatgacgtcgtcgctaaatgcatg
gagacgttctgtgaacgagatttagttctggtcgattccccgtattccgttcgtcatcat
acatacagtttcctggcggtgttcagtttttatgtggagaagctgaaaagtgagctttac
caaagaaatggcatgccgaacaccgaaatcaaatatgaaacggaggagcttgcgctcagc
gacgaggaaattgagcaatactatgttcctctcgatgacatgctcaccgaaactatcgtg
agagctttaaacagacttgttcggttcatgactcgttttgttgaacttggaaatgagaag
aatcatatgataagggagttaccgagtcatggatcatcggtatcaggtcatccggtcacc
ctcaacattgaactgaaaaacgacgatgatgacatcgattgcggtctgaatgcttggaaa
acattggtttgtgattcgagcaccactatcggagagctcaaattccgtctagcaaaacga
cttctgttccacgaagggatgactgatttcacagttcacaaaagagaagatgatatcacg
atgggagaagctaatcttcgatatgatttcttgacgctacaaaatgttaaggttgctact
gaaactgattccatttttctttcggaaaagattcgcattctagtgaaaccaaattcgtta
aggaaatcatcaagtcgcagatcagatagtcagatctatcaagtgaaccaaaagaaagct
ctcagggaggattttcttccaatcactatgatttctaagtgcaatttttacgatcttctc
cacgaactatcatctattggcgataagcacattcgagcctccgtgcgcaaactgatgctt
ctactgcccactcaaccgtctcttctaatgcaactaacattcagcgatacaaacacggag
gagcaaaatgctaaaatcacagaaatgtacgagcaatacatcaaccctgcagatccaggc
cgaatgctatatgcacttgaagcaatcagttctattattgctcccacgagaatgacatat
acagcaatgacaaaggcttctgaactgataaatgctcttcaaattaaagaaagcttcgtg
atcaaaaagctggtttacgagattctcgcgaaaccgcatgttattccactcaacaaatgc
tcgtctggcgatcgtcactcaatttttgaaagaattttgcaaatcgtcagaaccagtttc
actggacggaacgctttcatcaagactgtcaaaaacgagttacgagttcgtgatgaaatg
aagaagacatgtgatcgaatgattcaaagtcggcagaatccacgaccaatagatccgcca
atggaattcgcattgataagacaacaaatcgtgccacctgtaggtattgatcatcagcgg
tgcccctatttgaacactgaactcgatgttttcgagttcaaaatgtctttcggtacgtac
atggctaccatcaaagcttctctaaatgcatgggagctggctgatttgatcccattcttc
gagagaatccgcgattttcaatggattcacgtggctacagagagtctcgttgtcaagcag
attgatccattccgagagaagggtgcaccgcaagatccactgtcagaaactgctagtgat
ttgatcagatcagtcacgcgaggagaacgatgt

DBGET integrated database retrieval system