KEGG   Caenorhabditis briggsae: CBG03543Help
Entry
CBG03543          CDS       T01054                                 

Gene name
Cbr-emb-8
Definition
C. briggsae CBR-EMB-8 protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CBG03543 (Cbr-emb-8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 661 aa AA seqDB search
MLSSIVSSVDTSDLVLLTLLVGGAIVYFVSKYLNQPSSSRYSPTVASVTPSAVASKSNQS
FIDRMKNENRQVLIMYGSQTGTAEEMSGRLAKDLTRYSKKAVVVDPEDIEVEDLARLTEV
EDALLVLCMATYGEGDPTDNAVTLVEYLNAGDCDLSGVRFAVFGLGNKTYEHFNEIGIQM
DKQLEKLGAKRIFHLGLGDDDANLEEDFMIWREAFLPKVAEEFGWELNTEAETMRQYQLE
PVEEGKALFKGEFGRLGAYERPRPPFDVKNPYLATVAINDELHTEHSDRSCRHIEFSVEG
SRIRYEAGDHLAVFPTNDSALVDRLISILDFEPDRTFRLVNVDEDASKRHPFPCPTTFRT
ALSHYVDICAPVKSHVLKAISEYCTDESEKEYLNKLSVANEEGLKEYARYIVKERRSIVD
VLTDQKTCKPPIEYLLELLPRLQARYYSIASSPRVNEEKIAVCAVVTKYTIGDRLINGVC
TRYLTTKDAGSKSPVFVRKSTMRLPHRTTTQVIMIGPGTGFAPFRGFLQDRQFHKNAGKE
VGAMHLYYGCRHPDHDYIYKEELEKFQEDGVLTHLNCAFSRAQEKKIYVQDRLWETRDRI
WESINAGAHVYICGDARNMARDVQATLQKIFREVGGKSEYDAVAYFKDMEKTKRYQADVW
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctcgattgtgtcgagtgtcgacacatcggatctcgtgctgctcacactactc
gtcggaggagccatcgtctatttcgtctccaagtatctcaaccaaccatcgtcaagcagg
tactccccaacagtggcatcagtcacaccgtcagctgtggcctctaaatcgaatcagtca
ttcattgatcgcatgaaaaatgagaaccgacaggtcctcatcatgtacggatctcaaaca
ggaaccgccgaagagatgtcgggacgtttggcaaaggacctgaccagatattccaagaag
gcagtggtagtggaccctgaagatattgaagtcgaagacctggcccgtcttactgaggtc
gaagatgctcttttggttctctgcatggccacttatggagaaggagatccaactgataac
gctgtcaccctcgttgagtatctgaatgcgggagactgtgatttgagcggtgttcgattc
gcggttttcggattgggaaacaagacttatgagcatttcaatgagattggaattcaaatg
gataaacagctggagaagctcggagccaagcgaattttccatttgggactcggagatgac
gatgcgaatctggaggaggatttcatgatttggagagaggcattcttgccaaaagtagca
gaggaattcggatgggaactaaatacagaggcagagactatgcggcagtatcagttggag
ccagttgaggagggaaaagcactgttcaagggggaattcggaagacttggagcttacgaa
cggccacgtccaccattcgacgtcaagaatccatatctggcgactgtggcgatcaacgat
gagttgcacactgagcactcggatcgcagttgtagacatattgaattctcggttgaagga
tcccgaatccgctacgaagctggtgaccatctcgcagtgttcccaaccaacgactctgcc
ctcgtcgaccgtctcatctcgattctcgacttcgaaccagaccgcacattccgtctagtc
aacgtcgatgaggatgcatcgaagcgtcatccattcccatgcccaaccactttccgaacc
gctctctcgcactacgtggatatctgtgctccagtcaaatcccatgtcctcaaagcaatc
agcgagtactgtactgatgagagtgagaaggagtacttgaataaactatcggttgccaac
gaggaaggactcaaagagtacgctcggtacattgtcaaagaacgacgatcgattgtcgat
gtgttgactgatcagaagacgtgcaaaccgccaatcgagtatcttctcgagctgctgccg
cgtcttcaagctcgctactacagtatcgcatcgtcgccacgtgttaatgaggagaagatt
gcagtgtgtgcagtggttacaaagtataccattggtgatagattgatcaatggagtgtgt
accagatacttgaccaccaaggatgccggttccaagtctccagtcttcgtccgtaaatcc
acaatgcgtctcccacaccgtacaaccacacaagtgatcatgattggtccaggaactgga
ttcgccccgttccgtggcttcctccaagaccgtcaattccataagaacgctggaaaagaa
gtgggagcgatgcacttgtactacgggtgtcgtcatccggaccacgactacatttacaag
gaggagctggagaaattccaagaggacggagtgttgacccacttgaattgtgcattctct
agagctcaggaaaagaagatctacgtacaagaccgtctttgggagacacgcgatcgcatt
tgggaatccatcaacgccggggctcacgtctacatttgtggagatgctcgtaacatggct
cgtgacgttcaggcgacactccagaagatcttcagagaagtcggcggaaaatccgagtat
gatgctgtcgcctacttcaaggacatggagaagactaagagataccaagcggatgtctgg
tcataa

DBGET integrated database retrieval system