KEGG   Caenorhabditis briggsae: CBG03613Help
Entry
CBG03613          CDS       T01054                                 

Definition
Hypothetical protein CBG03613
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBG03613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG03613
   00620 Pyruvate metabolism
    CBG03613
   00640 Propanoate metabolism
    CBG03613
Enzymes [BR:cbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CBG03613
Lipid biosynthesis proteins [BR:cbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CBG03613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 680 aa AA seqDB search
MSDVRVKFNLTNGEDGQDEDIFNPPAPLLAGAHCSGLQNYHDLYRTSINDADGFWRNVAS
DLHFEQGTSKGLEYNFDAKAGPVYCKFMDGAKTNISYNCLERNIKRGLGDKIAYIFEGNE
PSDVSTWTYKELHAQVVQFSAVLRAHGVQRGDVVALYLPMIPELAVAMLACARIGAMHSV
VFAGFSAESLAARVVDARCRVVVTADGVFRGAKPIGLKSIADAAVALAAQEDVKVEAVIM
VEHLKRVTKPDGVELPKADYSEITFVYETEMQKCSGIDSPVEWMDAESPLFLLYTSGSTG
KPKGIQHTTAGYMTYAYATTKYTFDAKDDDVYWCTADCGWITGHSYLLYGPLMNGLKGIW
YEGVPTYPTPSRMWDAVDKYGVTKLYTSPTAARALMALGNKWLESTSRKSLKVIGTVGEP
INPAAWMWLYKKVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLL
DAEGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYFAPFNGYYFTGDGARRDEDGY
LWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGE
KIDEKLVAELKKMVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDT
TTLVDESVIKQLISGRSARA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgttcgcgtcaaattcaaccttaccaatggagaggatgggcaggatgaggat
atcttcaacccgccagcacctcttctcgccggtgcccactgctctggcctccaaaactac
cacgacctctaccgcacctcgatcaacgatgctgatggtttctggcgcaacgttgcctct
gaccttcacttcgagcaaggcacatccaaaggacttgagtacaatttcgacgccaaagct
gggccagtctactgtaaattcatggatggcgccaagacaaacatctcctacaactgcttg
gaacgaaatatcaaacgaggactgggagacaaaatcgcctatatctttgaaggaaacgag
ccatctgacgtctccacatggacctacaaagagttgcacgcacaagttgtccaattctcg
gcagttcttcgtgctcacggtgttcaacgcggagacgtcgttgctctttaccttccaatg
attccggaactcgccgttgctatgttagcatgcgcacgtatcggagcaatgcactctgtt
gtcttcgccggtttctctgctgaatctcttgctgctcgcgtcgtcgacgctcgttgtaga
gtagtggtgacagctgatggagtgttccgtggtgccaagccgattgggctgaagtcaatt
gcggatgcagctgtggcacttgccgctcaagaagacgtcaaagtggaagctgtcattatg
gtggagcatttaaagcgagtgacgaagccggatggagtggaacttccaaaagcggactat
tcggaaatcacatttgtatacgaaacagaaatgcaaaagtgctctggcatagactctccc
gtagaatggatggacgctgaatcccctctcttcctgctctacacatctggctccacagga
aaaccaaaaggaatccaacacacgacggccggctacatgacatatgcatacgccactaca
aagtacacattcgacgccaaagacgacgacgtttactggtgcaccgccgattgtggatgg
atcaccggacactcgtacttgctctatggccctctcatgaacggtctcaagggaatctgg
tacgagggtgtgccgacctatccgacgccttctagaatgtgggatgctgttgataagtat
ggtgtcaccaagctctacacgtcaccaactgccgctcgtgctctgatggctctcggaaat
aagtggcttgaaagcacttcccgaaaaagcctgaaggttatcggaaccgttggagagcca
atcaatccagccgcctggatgtggttgtacaagaaggttggactttcgaatgtctccatt
gtcgacacctactggcaaactgagactggaggacatatgatcacctgccttccaggagcg
actccaatgaaaccaggagccgccgctatgccattcttcggtgcctctcctgttcttcta
gatgctgaaggacgtgtgattgagggaccaggagagggatcattgtgtttcgatcgtgcc
tggccaggaatgatgagaggtatctatggagatgagcaacgtttcgtcaagacctacttt
gctccattcaacggatactatttcactggagatggtgcccgacgtgacgaggatggttac
ttgtggatcacaggacgtgttgatgatctcatgaacgtcagtggacatcttctatctact
gctgagatcgagtctgcccttgttgctcatgagaaggtagccgaggctgctgtcgttgct
gctccccatgatatcaaaggatcgttcccatacgcttttgtcacgctgaatgtgggagag
aagatcgacgagaagctagtcgccgagttgaagaagatggttcgtgagaagattggagcg
ttggctgtgccagatgtcattcaagaggctccaggacttccaaaaactcgctctggaaag
gtcactcgtagaatcctccgcaagattgctgaaggatcggagagcggcatcggcgacacc
accaccctcgtcgacgagtctgtcatcaagcaactcatttctggacgttctgcgagagca
taa

DBGET integrated database retrieval system