KEGG   Caenorhabditis briggsae: CBG03675Help
Entry
CBG03675          CDS       T01054                                 

Definition
Hypothetical protein CBG03675
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
cbr  Caenorhabditis briggsae
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CBG03675
Enzymes [BR:cbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     CBG03675
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     CBG03675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 414 aa AA seqDB search
SLAEIASKQENLELLAEGKTKQIFGIKGEKDYVLIRSKDSLTAFNAERKNELEGKSKIAS
KTTTNVFEYLQLLGLPTHFEQAVSDTEFIARKCTMIPIEWVARRVATGSFLKRNPGVKEG
FRFADLKLETFFKDDANDDPQWSDEQIVSNGLMIDHLRIGREEISLMKKMTKLVFRVLEK
AWALENSALIDMKIEFGVTVEGEILLADVIDNDSWRVWPENDRRLQLDKQVYRDMKEVTA
EGLQLVFKNYTKVMDITSSFSKPRQNCHVLVIMGSGSDGVFARKISDAAKGFGLETTLKV
SSAHKTTSDTLEVLAEFEESGVPTVVIAVAGRSNGLGPVIAGNSSLPVINCPPPSESMSL
DIWSSLRIPNGIGCTTVLDPSEAALAAAKILATHNHIVFGKVLTAQLKNQINIY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
agtttggctgaaattgcgtcgaaacaggagaatttggaattgctcgccgagggaaaaacc
aagcaaatttttgggattaaaggagagaaagactatgtcttaattcgttccaaagacagt
cttacggcattcaacgctgagcgcaaaaacgagctggagggaaaatcaaaaatcgctagc
aaaacgactacaaacgtttttgaatatcttcaactcctgggactccccacacattttgaa
caagccgtctcagacaccgaattcattgcccgtaaatgcacaatgatcccgattgaatgg
gtggccagacgtgtggccactggatcattcttaaaaagaaatccaggtgttaaggaagga
ttcagattcgccgatttgaaattggagacgtttttcaaggacgacgctaatgacgatcca
caatggagtgatgagcaaatcgtgtcgaatggattgatgattgatcatttgagaatcgga
agagaggagatttcgttgatgaagaagatgacgaaattggtgtttagagtactggagaag
gcgtgggcactggagaatagtgcattgattgatatgaagattgaattcggtgtgacagtt
gagggagagattctgttggctgacgtcatcgacaatgattcatggagagtttggccggag
aatgacagacgtcttcagttggataaacaggtgtatcgtgatatgaaggaagtgactgcc
gagggactacagttggttttcaaaaattatacaaaggtaatggacatcacctcaagcttc
tcaaaaccccgtcaaaattgccatgtcctcgtaatcatgggatctggatccgatggagtg
ttcgcaagaaaaatctcggatgccgccaagggttttggattggagaccactttgaaagta
agctccgcccacaagaccacttcggacactttggaagtgttggcggagtttgaggagagt
ggagtgcctacagtggtgatcgccgtggctggaagatccaatggtttgggaccagtcatt
gctggaaactcgtctttaccggtcatcaactgcccaccacccagtgaatcgatgagtcta
gacatctggagctctctccgtataccaaatggaatcggatgcaccacagtgctcgaccca
tccgaggctgcattggctgctgccaaaattctggccacccacaatcatatcgtgtttgga
aaagtgctcacagctcaactcaagaaccaaatcaatatttat

DBGET integrated database retrieval system