KEGG   Caenorhabditis briggsae: CBG03681Help
Entry
CBG03681          CDS       T01054                                 

Gene name
Cbr-tag-231
Definition
C. briggsae CBR-TAG-231 protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbr  Caenorhabditis briggsae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CBG03681 (Cbr-tag-231)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CBG03681 (Cbr-tag-231)
Transfer RNA biogenesis [BR:cbr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CBG03681 (Cbr-tag-231)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 319 aa AA seqDB search
MFNKASFLTRLVASSVRVSEAAGGIIKNVMAGGDLKIVDKAETGSGYDPQTEADRRAQYC
IVQSLQKHFNNITIIGEEEDTTACPEVELGFNEDVLLTDRLISPELAQIKENEVVVWVDP
LDGTSEVALAVKNKNLALLEQVTVLIGIAYKGRPVAGIIHQPYHSTSGRTVWAIKGCGVH
GLVPATGNTQKTVVTTRSHLSESVSSALEALKTRNLADNVEKVGGAGFKVLKVLEGCAAY
VFASAGCKKWDTCAVEAVLTAAGGRLTDISGREIRYEPDVQLNNTGGVLATASWVKHQEY
IETIPKDIKNNLPEVASKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaaagcgagcttcctcacacgtctcgtcgcatcgtccgttcgggtttcggaa
gcggctggtgggattattaagaatgtcatggccggtggagacctcaaaatcgtcgataaa
gcggaaaccgggtccggttacgatccacaaaccgaagccgatcgacgagcgcaatattgt
atcgttcagtcgctccagaagcattttaataatataacgatcattggggaagaggaagac
accaccgcctgccctgaagtagaactaggattcaatgaagacgtgcttctcacagatcgt
ctaatctctccagaattggcgcaaatcaaagagaacgaggtcgtcgtgtgggtggaccca
ctcgatggcacttctgaagtcgcgttggcggtgaaaaataagaatttggcgcttctggag
caggtgacggttctcattgggatcgcttataaaggacgtccggtcgctggaatcattcat
caaccctatcattcgacgagtggaagaacggtctgggcgattaaagggtgtggagtacat
ggattagtgccggcaacaggaaacactcaaaaaacggtcgtcacaacgcgcagccatctc
agcgagtcggtttcgagcgctctggaagcgctgaaaacccggaatctagcggataatgtc
gagaaagtgggcggagccggattcaaagttctgaaggtcctcgaaggctgcgcggcgtac
gtcttcgcaagtgccggatgcaagaaatgggacacttgcgccgtggaggctgtgctcacg
gccgccggcggtcggctcaccgatatcagtggccgagaaattcgctacgagccggacgtg
cagctaaacaacacgggcggtgtgctggcgacggcttcatgggtcaaacatcaggaatac
attgagacgatcccaaaagacatcaagaacaacttgccggaagtcgcttcgaagaaataa

DBGET integrated database retrieval system