KEGG   Caenorhabditis briggsae: CBG03681Help
Entry
CBG03681          CDS       T01054                                 

Gene name
Cbr-tag-231
Definition
C. briggsae CBR-TAG-231 protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbr  Caenorhabditis briggsae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cbr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 319 aa AA seqDB search
MFNKASFLTRLVASSVRVSEAAGGIIKNVMAGGDLKIVDKAETGSGYDPQTEADRRAQYC
IVQSLQKHFNNITIIGEEEDTTACPEVELGFNEDVLLTDRLISPELAQIKENEVVVWVDP
LDGTSEVALAVKNKNLALLEQVTVLIGIAYKGRPVAGIIHQPYHSTSGRTVWAIKGCGVH
GLVPATGNTQKTVVTTRSHLSESVSSALEALKTRNLADNVEKVGGAGFKVLKVLEGCAAY
VFASAGCKKWDTCAVEAVLTAAGGRLTDISGREIRYEPDVQLNNTGGVLATASWVKHQEY
IETIPKDIKNNLPEVASKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaaagcgagcttcctcacacgtctcgtcgcatcgtccgttcgggtttcggaa
gcggctggtgggattattaagaatgtcatggccggtggagacctcaaaatcgtcgataaa
gcggaaaccgggtccggttacgatccacaaaccgaagccgatcgacgagcgcaatattgt
atcgttcagtcgctccagaagcattttaataatataacgatcattggggaagaggaagac
accaccgcctgccctgaagtagaactaggattcaatgaagacgtgcttctcacagatcgt
ctaatctctccagaattggcgcaaatcaaagagaacgaggtcgtcgtgtgggtggaccca
ctcgatggcacttctgaagtcgcgttggcggtgaaaaataagaatttggcgcttctggag
caggtgacggttctcattgggatcgcttataaaggacgtccggtcgctggaatcattcat
caaccctatcattcgacgagtggaagaacggtctgggcgattaaagggtgtggagtacat
ggattagtgccggcaacaggaaacactcaaaaaacggtcgtcacaacgcgcagccatctc
agcgagtcggtttcgagcgctctggaagcgctgaaaacccggaatctagcggataatgtc
gagaaagtgggcggagccggattcaaagttctgaaggtcctcgaaggctgcgcggcgtac
gtcttcgcaagtgccggatgcaagaaatgggacacttgcgccgtggaggctgtgctcacg
gccgccggcggtcggctcaccgatatcagtggccgagaaattcgctacgagccggacgtg
cagctaaacaacacgggcggtgtgctggcgacggcttcatgggtcaaacatcaggaatac
attgagacgatcccaaaagacatcaagaacaacttgccggaagtcgcttcgaagaaataa

DBGET integrated database retrieval system