KEGG   Caenorhabditis briggsae: CBG03784Help
Entry
CBG03784          CDS       T01054                                 

Gene name
Cbr-npp-17
Definition
C. briggsae CBR-NPP-17 protein
Orthology
K14298  
mRNA export factor
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CBG03784 (Cbr-npp-17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 378 aa AA seqDB search
MTNEARMFGATGFGNKSLFGGSNLSTTASTTATATQNDDFFVDGAPEDTIQVIKFSPQPQ
DKPMIACGAWDGTTRVWMLNDSNNFEGKAQQNIPAPILDICWTEDSSKIFLACADKEARL
WDLASNQVAVVGTHDGPVKTCHWINGNNYQCLMTGSFDKTLRFWDMKNLPNQTQMASLTL
TERVYAADVLYPMAVVALANKRIKVFNLENGPSEVKDIESPLKFQIRCISIFRDKQNQNP
AGFALGSIEGRVAVQYVEAANPKDNFTFKCHRSADLVNGYQEIYAVNDICFHPQHGTLVT
IGSDGRYSMWDKDARTKLKTSEPHPMPLTCCDVHSSGALMVYALGYDWSRGHEGNTQPGS
KIVIHKCVDDMKPRVPKK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgaagcaagaatgttcggagcaacaggattcgggaacaaatcattgttcggc
ggatcgaatttgtctacgactgcgagcaccacagcgacggctacacagaatgacgacttt
tttgttgatggtgctccagaagatacgattcaagtgataaaattcagcccccaaccacaa
gacaagcctatgatagcatgtggagcttgggatggtacgactcgtgtttggatgctaaac
gactcgaataattttgaaggaaaggctcagcaaaacattccagctccaattttagacatt
tgttggactgaggatagttcaaaaatcttcctcgcttgtgcagacaaagaagcccgttta
tgggatctcgcctctaatcaagtcgcagtagttggaacacacgatggacctgtgaagacg
tgccactggattaatggaaacaattaccaatgcctcatgactggatcattcgacaaaaca
ctccggttctgggacatgaaaaacctaccaaaccaaacacaaatggcttcgctcacatta
accgagagagtttatgctgcagatgtcctttacccaatggcagttgtagccctagcgaac
aagcgtatcaaagttttcaacctcgaaaacgggccatcagaagttaaagacattgaaagt
ccactcaaattccaaatcagatgcatctcaatcttcagagacaaacagaatcagaaccca
gctggatttgctctcggctctatcgaaggccgtgtggccgtccagtacgttgaagctgcg
aatccaaaagacaatttcacttttaaatgccatcgatccgctgacctcgtcaacggatat
caagaaatctatgcggttaatgacatatgctttcatcctcagcacggaacactcgtgaca
atcggatcagatggacgatattccatgtgggacaaggacgctcgcacgaaactgaagaca
tcagaacctcatccgatgccattgacatgctgcgacgtgcatagttctggagcgctcatg
gtttacgctttgggatatgattggagcagaggacacgaaggaaatacacaaccagggtcg
aaaatcgttattcacaaatgtgtcgatgacatgaaaccaagagtcccgaagaagtga

DBGET integrated database retrieval system