KEGG   Caenorhabditis briggsae: CBG03799Help
Entry
CBG03799          CDS       T01054                                 

Definition
Hypothetical protein CBG03799
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CBG03799
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CBG03799
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CBG03799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 163 aa AA seqDB search
MSSVYDFTVKNANGDDVTLSQYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEV
LAFPCNQFAGQEPSCEVDIAAFVADKFKFEPTLFQKIDVNGDKASPLFTFLKNEKGGFMF
DAIKWNFTKFLVGRDGKIIKRLGPTTDPKDMKKDIEAALGERM
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtctacgattttacggtgaaaaacgccaatggtgacgatgtgacactatct
caatacaaaggaaaagtgctcattattgttaatgtggcatctcaatgtgggctgacaaac
aaaaattatacacagcttaaggaattgctcgatgtctacaaaaaagacgggcttgaagtt
ctggcattcccctgtaatcagtttgctggccaggagccgtcttgcgaagtcgacattgct
gctttcgtcgcagacaaattcaaatttgagccaacacttttccagaaaattgatgttaat
ggagacaaggcatcaccactattcactttcctaaaaaatgagaaaggcggattcatgttc
gatgcaatcaaatggaatttcacaaagtttttggtaggacgcgatggaaagatcatcaag
agattgggaccaacaactgatccaaaagatatgaaaaaggacattgaggcagctctggga
gaacgaatgtaa

DBGET integrated database retrieval system