KEGG   Caenorhabditis briggsae: CBG03922Help
Entry
CBG03922          CDS       T01054                                 

Gene name
Cbr-sir-2.4
Definition
C. briggsae CBR-SIR-2.4 protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CBG03922 (Cbr-sir-2.4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 293 aa AA seqDB search
MTSVYESLLSEYPDKGVVGKPEIRDTEDQMIEKLRVLTNHFRNAKDTEKPIFVLIGAGVS
TGSKLPDFRGKQGVWTLQAEGKHAEGSLVRVQARPGVSHKCILALHKAGYIKTIITQNVD
GLDRKVGIPVEDLIEVHGNLFLEVCQSCFSEYVRENIVMSVGLKPTGRNCEGNKKTGRSC
RGKLRDATLDWDSEIDHKHLTKIKKTWKESSHLLCIGTSLEIIPMGSLPVDAKARGIKTT
TINYQETAHEKIVETAIHADVKLILYSLCHSLGVEVDLGNDLPDEVPVPLEIC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgtatacgagagtctattatcagagtatcctgataaaggcgttgtcggaaaa
ccagagatccgggacacggaagatcagatgatcgagaagcttcgagtcctcacgaatcac
ttccgaaacgccaaagatacggaaaaacccatttttgtgttaatcggagctggagttagt
acgggctcgaagcttccggatttcaggggaaaacaaggtgtttggacgttacaagcagaa
ggaaaacatgcagaaggcagtttagtgagagttcaggctcgtccaggcgtttcgcataaa
tgcattctggctctacacaaagcgggatatatcaaaacgataatcactcaaaatgtggat
ggattggatcgaaaagtgggaatccctgtggaagatctgatcgaagtgcacggaaatctg
ttcttagaagtttgtcaatcgtgttttagtgaatatgtgcgagaaaacattgtgatgagt
gttggattgaaaccaactggccgcaattgtgaaggaaacaaaaaaacaggtcgttcctgt
cgtggaaagcttcgtgatgctactctagattgggactctgaaatcgaccataagcatctg
acgaaaatcaaaaagacatggaaagaatcttcacatcttctttgcatcggaacttccctt
gaaatcatcccaatgggttctcttccagtcgacgcaaaagctcgcggaatcaaaactact
actattaactaccaagaaactgctcatgaaaaaatcgtggagactgcaatccatgcggat
gtcaaactgattctctactcactatgtcactcactcggcgttgaagttgatctcggaaac
gatctccctgatgaagtgcctgtaccattggaaatttgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system