KEGG   Caenorhabditis briggsae: CBG03956Help
Entry
CBG03956          CDS       T01054                                 

Gene name
Cbr-rpa-2
Definition
C. briggsae CBR-RPA-2 protein
Orthology
K10739  
replication factor A2
Organism
cbr  Caenorhabditis briggsae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CBG03956 (Cbr-rpa-2)
   03420 Nucleotide excision repair
    CBG03956 (Cbr-rpa-2)
   03430 Mismatch repair
    CBG03956 (Cbr-rpa-2)
   03440 Homologous recombination
    CBG03956 (Cbr-rpa-2)
   03460 Fanconi anemia pathway
    CBG03956 (Cbr-rpa-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 286 aa AA seqDB search
MWNETADHEHGAGGWAGGESSFMTDRKPDSKAATLGDRLPVPVTISNLNEHFSATDDKYI
IGNFRFATVQTVGIVKEINQEGTTWSYDLCDPNNEAMEYRALKYENEGSNSDQSSIVEGT
RVRAIGKLKSFDGSNSIMLFNITPVTDDKDFTIFELEAEAARLFFQKNMNDKLKSDASSR
GFQGMLAPPKSRAGQQPMQQSSQGSDKKERLYPAQSQVNVEGDLRQRVTAVLKGVSEEAH
EEGSNILWIAEQLQEKDIKKLRDCLSGMVENGLAYTTTDEETFSVI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgaaactgccgatcacgaacacggtgccggaggatgggctggaggagagtct
tccttcatgaccgacagaaaaccagattcgaaagccgccacacttggagacagacttccg
gttccagttaccatctctaacctcaacgagcacttttctgccactgatgacaagtacata
attggaaactttcgtttcgctactgtccaaaccgtcggaattgtgaaggagataaaccaa
gagggaacaacctggagctacgatctttgtgatccaaacaacgaggccatggagtaccgt
gcgctgaaatacgagaacgaaggatcgaactccgatcagtcttcaattgtggagggaact
cgtgtccgtgctatcggaaagctgaagagtttcgatgggagcaactccatcatgcttttc
aacatcactcctgtcacggacgacaaagattttaccatcttcgagctcgaagccgaagca
gctcgtctctttttccaaaagaacatgaatgataagctcaaatcggatgcttcttctaga
ggattccaaggaatgttggccccgccaaagagcagagctggacaacagccgatgcagcaa
agctcgcaaggatctgacaaaaaagagagattgtatccagctcagtctcaagttaatgtt
gaaggagaccttagacaacgtgtcactgccgttctgaagggcgtctctgaagaggctcac
gaagagggatcaaacattctctggattgctgaacaacttcaagagaaagacatcaagaag
ttgcgcgactgtctctctggaatggtcgaaaatggactggcctacactactactgatgaa
gaaaccttctccgtcatctaa

DBGET integrated database retrieval system