KEGG   Caenorhabditis briggsae: CBG04030Help
Entry
CBG04030          CDS       T01054                                 

Gene name
Cbr-air-2
Definition
(RefSeq) C. briggsae CBR-AIR-2 protein
  KO
K11479  
aurora kinase B [EC:2.7.11.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CBG04030 (Cbr-air-2)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   CBG04030 (Cbr-air-2)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBG04030 (Cbr-air-2)
Chromosome [BR:cbr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     CBG04030 (Cbr-air-2)
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CBG04030 (Cbr-air-2)
  Sister chromatid separation proteins
   Aurora kinases
    CBG04030 (Cbr-air-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
UniProt: 
Position
I
AA seq 302 aa AA seqDB search
MENKPQILQTKSKNTPNKGGKLSINDFEIGRPLGKGKFGSVYLARTKTGHFHCAIKVLFK
SQLISGGVEHQLEREIEIQSHLQHPNIIRLYNYFWDAKKIYLILEYAPGGEMYKQLTTQK
RFTEAMAGKYMYEIADALSYCHRKNVIHRDIKPENLLIGAQGELKIGDFGWSVHAPSNKR
QTMCGTMDYLPPEMVNGNSHSDAVDLWAIGVLCYEFLVGKPPFEHENQADTYSAIKAGRF
TYPDFVKKGARDLIGKLLVVDPRRRCSLQEVKDHYWVTSMLDSCRRAAEKQKAERAASLR
DH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataagccccaaatacttcaaactaaatcgaaaaacactccgaacaagggagga
aaattgtctattaacgatttcgaaattggacgacctctgggaaagggtaaatttggaagc
gtctacctcgcgagaacgaaaacgggtcatttccactgtgccataaaagtactcttcaaa
tcacaactgatttctggaggagtcgaacatcagctggaacgggaaatcgaaattcagtcc
catctacaacatccgaatatcatccggctctacaattatttctgggatgcgaaaaagatt
tacctgattctcgaatacgctccaggtggtgaaatgtacaagcaactcaccacacagaaa
aggttcactgaagcaatggctggaaaatatatgtatgaaattgccgatgctctgtcttac
tgtcatagaaaaaacgtcattcatcgagacatcaagcctgagaacttattgattggggca
caaggagaactgaaaataggagatttcggatggagtgttcatgcgccttccaacaagcgt
caaacaatgtgtggaacaatggactacctgccaccagaaatggtcaatggaaattcgcat
agtgacgccgtcgatttatgggctatcggagtgctttgctacgaattcctggtgggcaaa
ccgccatttgaacacgagaatcaagccgatacctactctgcaatcaaagctgggagattc
acatatcccgattttgtgaagaaaggagcaagagatctaattggaaaacttctcgttgtt
gatccaaggagaagatgttcacttcaggaggtgaaagaccactactgggtcacatcgatg
ttggacagctgccgacgagctgctgagaaacagaaggctgaaagagcagcaagtcttcgg
gaccactag

DBGET integrated database retrieval system