KEGG   Caenorhabditis briggsae: CBG04131Help
Entry
CBG04131          CDS       T01054                                 

Gene name
Cbr-ife-4
Definition
C. briggsae CBR-IFE-4 protein
Orthology
K03259  
translation initiation factor 4E
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cbr03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cbr04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 214 aa AA seqDB search
METEEVAVFAETPKVPRNLPMLMSETPIRLNDHPIQYSYTFSYFVRPSGKFDPEDYASYV
QPVGVMKTVEQFWGIMSHFRRPTDLCDKADIHFFKTGIKPVWEDPANCKGGKWIIRLKKG
LSSRIWENLLLAVVGEQFEIGDELCGAVCSIRNQEDIISLWNRNADETPVTNRIRDTLRK
VLNLPQNTVLEYKRHDDCLRDQSSYRHTNKNILK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagaagaagtggcagtgtttgcagagacaccgaaagttcctaggaatttacca
atgctaatgagcgaaacgccaattaggttaaacgaccatccaattcaatattcctacacg
ttctcctattttgtgagaccatctgggaagtttgacccggaggattatgcaagctatgtt
cagccggttggagtaatgaaaacagttgaacagttttgggggatcatgtcacattttcga
cgcccaacagatctgtgtgacaaagcggatatacacttcttcaaaactggaatcaagcct
gtctgggaagatccagcaaactgcaaaggtggaaaatggattattcgtctgaagaaagga
ttatcctctcgtatttgggagaatctactactggctgttgttggagaacaatttgaaatt
ggagatgaactgtgtggagcggtgtgttcaattcgcaatcaagaagatatcatttcatta
tggaatagaaacgctgacgagactcctgtgacaaaccgaatccgtgatactctccgcaaa
gttttgaaccttccgcaaaatactgttcttgagtacaaacgtcacgatgactgcctgaga
gaccaaagctcctatcgacacactaacaaaaacattctgaaataa

DBGET integrated database retrieval system