KEGG   Caenorhabditis briggsae: CBG04190Help
Entry
CBG04190          CDS       T01054                                 

Gene name
Cbr-mek-2
Definition
C. briggsae CBR-MEK-2 protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cbr04012]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cbr04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cbr04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 387 aa AA seqDB search
MSSGKRRNPLGLSLPPTVNEQSECGEAAAEEATATVPLEEQLKKLGLTEPQTQRLSEFLL
AKEGIKELSEDMLQTEGELGHGNGGVVNKCVHKKTGVIMARKLVHLEIKPSVRQQIVKEL
AVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVR
GLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERL
TGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVSENEIELADTLEEATYHA
PSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTSDVFF
TQYADSDDQGEFADFVKGTLNLPKLNP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtggaaaacggcgtaatccgcttggactcagtctacctccaacggtgaatgaa
caaagcgaatgtggcgaggcagccgcggaagaagcaaccgccactgttccactcgaagaa
caactaaaaaaacttgggcttacagaaccacagacacagcgtctcagtgagtttctttta
gcgaaggagggaataaaggagttaagcgaagatatgttgcaaactgaaggcgaactgggg
catggtaatggtggcgttgtcaacaaatgcgttcataaaaagacaggagtcataatggct
cgtaaactggtccatctggaaatcaaaccatccgtacgccagcagattgtcaaagaatta
gcagttcttcacaagtgtaacagtcctttcatcgtcggattttatggcgcttttgtggat
aacaatgacatatcgatatgcatggaatacatggatggactttcacttgacatagttctc
aaaaaagttggccgccttcctgaaaagttcgtcggaagaatttcggtggctgttgtcaga
ggattgacatacttgaaagacgaaatcaagatcttgcacagagatgtcaagccgtccaac
atgcttgttaatagtaacggagagatcaaactgtgtgattttggtgtgtcaggaatgctg
atcgactctatggctaactcattcgttggtaccagaagctacatggcaccggaacgactg
acaggatctcattacaccatttcatcggacatttggtcgtttggcttgtccctcgttgag
cttctgataggacgatatcctgttccagctccatctcaagccgagtatgctacaatgttc
aatgtgtcagaaaatgaaatagagctcgctgatactctcgaagaagccacatatcatgca
ccaagcaatcctgcttcgatggcgattttcgagatgcttgactacattgtcaacggacca
cctccaacccttccgaaacgcttttttactgatgaagtcattggattcgtatctaaatgt
ctccggaagcttccaagtgagcgtgcaacactgaaatctctcacgtctgatgtatttttc
actcaatatgccgacagtgacgatcaaggagaatttgcggattttgtgaaaggcactctc
aacttgcccaagttgaacccataa

DBGET integrated database retrieval system