KEGG   Caenorhabditis briggsae: CBG04190Help
Entry
CBG04190          CDS       T01054                                 

Gene name
Cbr-mek-2
Definition
C. briggsae CBR-MEK-2 protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG04190 (Cbr-mek-2)
   04012 ErbB signaling pathway
    CBG04190 (Cbr-mek-2)
   04068 FoxO signaling pathway
    CBG04190 (Cbr-mek-2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CBG04190 (Cbr-mek-2)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CBG04190 (Cbr-mek-2)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CBG04190 (Cbr-mek-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 387 aa AA seqDB search
MSSGKRRNPLGLSLPPTVNEQSECGEAAAEEATATVPLEEQLKKLGLTEPQTQRLSEFLL
AKEGIKELSEDMLQTEGELGHGNGGVVNKCVHKKTGVIMARKLVHLEIKPSVRQQIVKEL
AVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVR
GLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERL
TGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVSENEIELADTLEEATYHA
PSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTSDVFF
TQYADSDDQGEFADFVKGTLNLPKLNP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtggaaaacggcgtaatccgcttggactcagtctacctccaacggtgaatgaa
caaagcgaatgtggcgaggcagccgcggaagaagcaaccgccactgttccactcgaagaa
caactaaaaaaacttgggcttacagaaccacagacacagcgtctcagtgagtttctttta
gcgaaggagggaataaaggagttaagcgaagatatgttgcaaactgaaggcgaactgggg
catggtaatggtggcgttgtcaacaaatgcgttcataaaaagacaggagtcataatggct
cgtaaactggtccatctggaaatcaaaccatccgtacgccagcagattgtcaaagaatta
gcagttcttcacaagtgtaacagtcctttcatcgtcggattttatggcgcttttgtggat
aacaatgacatatcgatatgcatggaatacatggatggactttcacttgacatagttctc
aaaaaagttggccgccttcctgaaaagttcgtcggaagaatttcggtggctgttgtcaga
ggattgacatacttgaaagacgaaatcaagatcttgcacagagatgtcaagccgtccaac
atgcttgttaatagtaacggagagatcaaactgtgtgattttggtgtgtcaggaatgctg
atcgactctatggctaactcattcgttggtaccagaagctacatggcaccggaacgactg
acaggatctcattacaccatttcatcggacatttggtcgtttggcttgtccctcgttgag
cttctgataggacgatatcctgttccagctccatctcaagccgagtatgctacaatgttc
aatgtgtcagaaaatgaaatagagctcgctgatactctcgaagaagccacatatcatgca
ccaagcaatcctgcttcgatggcgattttcgagatgcttgactacattgtcaacggacca
cctccaacccttccgaaacgcttttttactgatgaagtcattggattcgtatctaaatgt
ctccggaagcttccaagtgagcgtgcaacactgaaatctctcacgtctgatgtatttttc
actcaatatgccgacagtgacgatcaaggagaatttgcggattttgtgaaaggcactctc
aacttgcccaagttgaacccataa

DBGET integrated database retrieval system