KEGG   Caenorhabditis briggsae: CBG04247Help
Entry
CBG04247          CDS       T01054                                 

Gene name
Cbr-eif-3.B
Definition
C. briggsae CBR-EIF-3.B protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cbr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 722 aa AA seqDB search
MVEIDFNKENEEDYSDPADFVDDVTDDVLVPDVLYKKPTIDEFEGNVFIAGIPVVGAERI
ARLQSVLKKVLEKLEPGVKIFIPPSPEGGSLGVLLTEWPDSRSAAFAVKSLDGYSFDKNH
TFSARFFTDMKKLEAPSDAWTTPVKSEYSDVGDLWWWLQNERCRDQFAISHDKLGIPTVG
VFTNMKGNDPELAGDPEKAERANWTETVFTWSPHGSYLSTIHKRGIILWGGKDYARAHRF
AHDNVQYIDFSPCETFLDTYAPEENNSWGDLRRKFLRVWDRTGELKKAYSTFELTGRTQL
PTWPFFKWSIDEKYFACLKAPEKDKLEREKKIDGISIFESETFELVDKRAVTIENIKHFD
WSPTAPILAYYSECTDAVPAEFGLLQVPSMQRLRSARVHNVADAQMFWQKSGKRLAFYTM
RYKKKEFRETGEVKYVGGCQYHVDIFEIDKKDVSLMNLPLAEPFIHFDWDPEGDKFCVLV
GNTAKATPQVYKIEANSHAPKLVSKLDAGVHFNEVQFAPKGGWLAVLAKVSAGGNVYFID
TSLAEAKRTNVIEHPLFNKGYWDPTGRYFVTCSTLGGRAGADLGYRIFTFQGRELCRKNL
DRLAQFKWRPRPPVKLSEQKQNEIRKNLKKTAAKFVKQDDDEKCRASQEVVEKRRKIMAA
FDVIRNRNRECLENTRHLRIALRDGVDTEAQLDEDEFVDEEITIALSTSKTAAPLSEEDE
RD
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaatagattttaataaggagaacgaggaggattactccgatccagcggatttc
gttgacgatgtaaccgatgatgttctcgtccccgatgttctttacaaaaagccaaccatc
gatgagtttgaaggcaacgtcttcatcgccggtatcccagttgttggtgccgaacgtatc
gctagactccaaagtgtgttgaagaaggttctagagaaattggagccaggagtcaagatt
ttcatcccaccaagcccagaaggaggatctttgggagtccttctcaccgagtggcccgac
agccggtccgccgcgttcgctgtgaaaagtcttgatggctactctttcgacaagaaccac
accttctcagcccgctttttcacggatatgaagaagttggaagctccatctgatgcctgg
acgactccagtgaagtcagaatactcggatgttggagatttgtggtggtggcttcagaat
gagcgttgccgtgatcagttcgcaatttctcatgataaattgggaataccaactgttggc
gtgttcacgaatatgaagggaaacgatccagagcttgctggagatccggagaaggccgag
agagctaactggactgaaaccgtcttcacctggtcaccacatggttcctatctctccacg
atccacaagcgaggaataatcctctggggaggcaaagactacgctcgtgcccaccgattc
gcccatgacaacgttcaatacattgatttctcgccatgcgaaaccttcctggacacctac
gcccctgaagagaacaacagctggggagacttgagaagaaagttcctgagagtttgggat
cgaactggagaattgaagaaggcctactcgacctttgagctcacaggaagaactcagctg
ccaacgtggccattcttcaaatggtccatcgacgagaagtactttgcatgtctcaaggct
ccagagaaggataagcttgaaagagagaagaagatcgatggaatctcgatttttgagtcg
gaaaccttcgaacttgttgacaaacgagccgttacgattgagaatatcaagcactttgac
tggtcaccaactgctccaatccttgcttattattctgagtgcacagacgcagttccagct
gagttcggacttcttcaagttccatccatgcaacggctgcgttcggctcgcgttcacaac
gtcgccgatgctcaaatgttctggcagaagagtggaaagcggttggcgttctacacgatg
agatataagaagaaggagttcagagagactggagaggttaaatatgtgggtggctgccaa
taccatgtggacatcttcgagattgacaagaaggacgtctccctgatgaacctccctctt
gcagaaccattcatccactttgactgggatccagaaggcgacaagttctgtgttctcgtc
ggaaacaccgccaaagccacaccccaggtctacaagatcgaagccaacagccacgcgccg
aaacttgtgagcaaattggacgccggagttcacttcaatgaggtccaattcgccccgaaa
ggaggatggttggcggttcttgccaaggtgtcagctggtggaaatgtgtatttcattgat
acttcgctggcggaagctaagagaaccaatgtcatcgagcatccattgttcaataaggga
tattgggatccaactggacgctactttgtcacatgctccacgttgggaggaagagctgga
gccgacttgggataccgaattttcacattccaaggacgagaactctgccggaaaaacttg
gatcgtctggcgcaattcaagtggagaccaagaccgccggtgaagttgagtgagcagaag
cagaacgagattaggaagaatttgaagaagaccgccgccaaattcgtgaagcaagacgac
gatgagaagtgtcgggcgtcgcaggaggtcgttgagaagcgtcgcaagattatggccgcg
ttcgacgtcatcagaaaccgaaatcgtgaatgtttggagaacacccgtcatttgcgcatc
gcactgcgcgacggagtggacaccgaagcccaactggacgaggatgaatttgtggacgaa
gagattacaattgcgttgagcacgagcaaaaccgccgcacctctatcggaggaggacgag
agggactaa

DBGET integrated database retrieval system