KEGG   Caenorhabditis briggsae: CBG04264Help
Entry
CBG04264          CDS       T01054                                 

Definition
Hypothetical protein CBG04264
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG04264
   00330 Arginine and proline metabolism
    CBG04264
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CBG04264
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CBG04264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 780 aa AA seqDB search
MSMMDNVAEKGGIFDALRVDSNDPNDSLREEASTTPKIDEKNLEYIGEVLERKKSVVPFL
TQTINQLALVRNEKMERAADLICTLFRLPHGSTDCSFFRLIKVLRSFGIWENDPRLKQMF
DRMKKHDEENEDSRQWAMSQEKFKEIIFPCTILISRTLRNQLIIPSWLEFTQMIDTIFES
CRESKEGEVASYIPQLARQSPHTWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVA
SEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDF
MLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQGLREELDLYFQ
LCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQV
GLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDQFNFHNYDSLLHP
DDSRKIDPRRKIGPRENETIVQVMYAAKNGDLDSLRRMFMQGADLKTADYDNRTALHVAA
AEGRIKVCKFLVNIVGIPHDVKDRWGRYPLDDARQFKNKEVALYLFRLQYPTKRMPENWF
EVGGDLLVSELENAADNIDDNVESSGEDEGITGMLTDDLEKREWALHANGNMGEINYQLV
RRKSSKAPPTPEQKPLTFGYGSLAKHHPEKQHHHEKKKHHAPQSQHEPPQHLFHNGAGGH
HLNGNGVHSNGHHHLPSHVMMLNGAAGGLNSRRLSSPMEQDEDNVRKSSSSQDLMKSLDV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgatggataatgttgcggagaagggcggcattttcgacgcgctacgcgtcgat
tccaacgatccgaacgattcgttgagagaggaagcgtcgacgacgccgaaaattgatgag
aagaatttggaatacattggagaagtgctggaacgcaagaaatcggtggttcccttcctc
acccagacgatcaatcaactcgcattggtgagaaatgagaaaatggaacgagctgctgat
ctgatttgtacgctctttcgtctcccgcacggatcaactgattgctcattcttccgactg
attaaagtgctccgatcgtttggaatatgggagaatgatccacgtctcaaacagatgttc
gatcgaatgaagaagcatgacgaggagaatgaggactcgagacagtgggcaatgtcacag
gagaagtttaaagaaataatcttcccgtgcacaattctgatctctcgtacactccgcaat
cagctaattattccgtcgtggctcgagttcactcaaatgatcgacacaatttttgaatca
tgtcgtgaatccaaagaaggcgaagtggcttcgtacattcctcaactggctcgacagagt
ccacacacatggggaatgtcgatttgtacgattgacggacaacgattctcgttgggtgac
tcaaaaaagaacttctgccttcaatccgtctccaaagcgttcaattatgcaatcgtcgct
tcggaaatcggatcacacgtacttcatcaatatgttggacacgagccaagtggacggctc
ttcaatgagatttgtttggattctaataacatgccccataatccactgatcaacgctgga
gcgatcgtcgtcacctcaatgatcaaaccgacgcattcgatggcggatcgtttcgatttt
atgctcaaacagtacagaaaacttgccggtggtggacatgtcggatttgataatgctaca
ttcctctcggaacgagacacggccgatcgaaactacgctctatcgtactacatgaaagag
tatcgatgcttcccagacgaatctcagggacttcgtgaggagctcgacctatatttccaa
ttgtgctcattggaaaccaattgcgacaccgcggcggtgatggctgccacgttggcaaac
ggaggaatctgtccgctgacgacggagaagtgtctcggatcccgcccatgtcgtgatatt
ctttcgttgatgtactcgtgtggaatgtacgattactccggaaaatttgcgttccaggtc
ggacttccagcgaaatccggagtctccggtataatgatcgttgtgattccgaacgtgatg
ggcatcgctctctactctccaccactcgacaagactggaaactcgtgtcgtggtgttgca
ttctgtcgtcaactcatcgaccagttcaacttccacaactacgattcgctgctgcatccg
gacgactcgcgtaaaatcgatccgcgacgaaagatcggtccacgtgagaacgagacgatt
gtgcaggtcatgtacgcggcgaagaacggagatttggattcgctccgtcgaatgttcatg
caaggagccgatctgaaaacagccgactacgataatcgtacggctctgcacgtggcagcc
gccgagggacgaatcaaagtttgcaagtttttggtgaatatcgttggaattccgcatgat
gtcaaggatagatggggacgctatccactcgacgacgcacgtcaattcaagaacaaagag
gtggctctctacctattccgtctccaataccccacaaaacgaatgccagagaattggttc
gaagtgggcggagacttattggtgtcggaattggaaaacgccgctgataacatcgatgac
aacgttgagagttctggtgaggatgaaggaattactggaatgttgacggatgatttggag
aagagagaatgggcacttcatgccaatggaaatatgggagaaatcaactaccagctggtt
cgccgaaagtcatccaaagctccgcccactcccgaacaaaaacccctgacatttggatac
ggatccctagccaaacatcacccggaaaagcagcaccaccacgaaaagaagaagcatcat
gctccacagtcccaacacgagccaccacaacatttattccataacggagcaggaggacat
catctgaatggaaatggagtgcattcgaatggacatcatcatctgccgagccacgtgatg
atgctcaatggagcagccggtgggctcaattcgagacggctcagttcgccaatggaacag
gacgaggataatgtgcgtaaaagctccagttcacaggatttgatgaaatctctggatgtt
taa

DBGET integrated database retrieval system