KEGG   Caenorhabditis briggsae: CBG04264Help
Entry
CBG04264          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG04264
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00220  Arginine biosynthesis
cbr00250  Alanine, aspartate and glutamate metabolism
cbr00471  D-Glutamine and D-glutamate metabolism
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG04264
   00220 Arginine biosynthesis
    CBG04264
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CBG04264
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CBG04264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 8571850
NCBI-ProteinID: XP_002630335
WormBase: CBG04264
Position
II
AA seq 780 aa AA seqDB search
MSMMDNVAEKGGIFDALRVDSNDPNDSLREEASTTPKIDEKNLEYIGEVLERKKSVVPFL
TQTINQLALVRNEKMERAADLICTLFRLPHGSTDCSFFRLIKVLRSFGIWENDPRLKQMF
DRMKKHDEENEDSRQWAMSQEKFKEIIFPCTILISRTLRNQLIIPSWLEFTQMIDTIFES
CRESKEGEVASYIPQLARQSPHTWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVA
SEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDF
MLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQGLREELDLYFQ
LCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQV
GLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDQFNFHNYDSLLHP
DDSRKIDPRRKIGPRENETIVQVMYAAKNGDLDSLRRMFMQGADLKTADYDNRTALHVAA
AEGRIKVCKFLVNIVGIPHDVKDRWGRYPLDDARQFKNKEVALYLFRLQYPTKRMPENWF
EVGGDLLVSELENAADNIDDNVESSGEDEGITGMLTDDLEKREWALHANGNMGEINYQLV
RRKSSKAPPTPEQKPLTFGYGSLAKHHPEKQHHHEKKKHHAPQSQHEPPQHLFHNGAGGH
HLNGNGVHSNGHHHLPSHVMMLNGAAGGLNSRRLSSPMEQDEDNVRKSSSSQDLMKSLDV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgatggataatgttgcggagaagggcggcattttcgacgcgctacgcgtcgat
tccaacgatccgaacgattcgttgagagaggaagcgtcgacgacgccgaaaattgatgag
aagaatttggaatacattggagaagtgctggaacgcaagaaatcggtggttcccttcctc
acccagacgatcaatcaactcgcattggtgagaaatgagaaaatggaacgagctgctgat
ctgatttgtacgctctttcgtctcccgcacggatcaactgattgctcattcttccgactg
attaaagtgctccgatcgtttggaatatgggagaatgatccacgtctcaaacagatgttc
gatcgaatgaagaagcatgacgaggagaatgaggactcgagacagtgggcaatgtcacag
gagaagtttaaagaaataatcttcccgtgcacaattctgatctctcgtacactccgcaat
cagctaattattccgtcgtggctcgagttcactcaaatgatcgacacaatttttgaatca
tgtcgtgaatccaaagaaggcgaagtggcttcgtacattcctcaactggctcgacagagt
ccacacacatggggaatgtcgatttgtacgattgacggacaacgattctcgttgggtgac
tcaaaaaagaacttctgccttcaatccgtctccaaagcgttcaattatgcaatcgtcgct
tcggaaatcggatcacacgtacttcatcaatatgttggacacgagccaagtggacggctc
ttcaatgagatttgtttggattctaataacatgccccataatccactgatcaacgctgga
gcgatcgtcgtcacctcaatgatcaaaccgacgcattcgatggcggatcgtttcgatttt
atgctcaaacagtacagaaaacttgccggtggtggacatgtcggatttgataatgctaca
ttcctctcggaacgagacacggccgatcgaaactacgctctatcgtactacatgaaagag
tatcgatgcttcccagacgaatctcagggacttcgtgaggagctcgacctatatttccaa
ttgtgctcattggaaaccaattgcgacaccgcggcggtgatggctgccacgttggcaaac
ggaggaatctgtccgctgacgacggagaagtgtctcggatcccgcccatgtcgtgatatt
ctttcgttgatgtactcgtgtggaatgtacgattactccggaaaatttgcgttccaggtc
ggacttccagcgaaatccggagtctccggtataatgatcgttgtgattccgaacgtgatg
ggcatcgctctctactctccaccactcgacaagactggaaactcgtgtcgtggtgttgca
ttctgtcgtcaactcatcgaccagttcaacttccacaactacgattcgctgctgcatccg
gacgactcgcgtaaaatcgatccgcgacgaaagatcggtccacgtgagaacgagacgatt
gtgcaggtcatgtacgcggcgaagaacggagatttggattcgctccgtcgaatgttcatg
caaggagccgatctgaaaacagccgactacgataatcgtacggctctgcacgtggcagcc
gccgagggacgaatcaaagtttgcaagtttttggtgaatatcgttggaattccgcatgat
gtcaaggatagatggggacgctatccactcgacgacgcacgtcaattcaagaacaaagag
gtggctctctacctattccgtctccaataccccacaaaacgaatgccagagaattggttc
gaagtgggcggagacttattggtgtcggaattggaaaacgccgctgataacatcgatgac
aacgttgagagttctggtgaggatgaaggaattactggaatgttgacggatgatttggag
aagagagaatgggcacttcatgccaatggaaatatgggagaaatcaactaccagctggtt
cgccgaaagtcatccaaagctccgcccactcccgaacaaaaacccctgacatttggatac
ggatccctagccaaacatcacccggaaaagcagcaccaccacgaaaagaagaagcatcat
gctccacagtcccaacacgagccaccacaacatttattccataacggagcaggaggacat
catctgaatggaaatggagtgcattcgaatggacatcatcatctgccgagccacgtgatg
atgctcaatggagcagccggtgggctcaattcgagacggctcagttcgccaatggaacag
gacgaggataatgtgcgtaaaagctccagttcacaggatttgatgaaatctctggatgtt
taa

DBGET integrated database retrieval system