KEGG   Caenorhabditis briggsae: CBG04366Help
Entry
CBG04366          CDS       T01054                                 

Gene name
Cbr-pfn-1
Definition
(RefSeq) C. briggsae CBR-PFN-1 protein
  KO
K05759  
profilin
Organism
cbr  Caenorhabditis briggsae
Brite
Membrane trafficking [BR:cbr04131]
 Others
  Actin-binding proteins
   Others
    CBG04366 (Cbr-pfn-1)
Cytoskeleton proteins [BR:cbr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     CBG04366 (Cbr-pfn-1)
Exosome [BR:cbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CBG04366 (Cbr-pfn-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 132 aa AA seqDB search
MSGWNAYIDTMTAAAPSIKRAAIVGATDGAVWARTEDANVFKATEAELKTFVNLFQDVTA
VPGKGADIEGVHYVVPRSEETLIFGKKENTGFFAAKTKSAVLIAVYEGPNEVAAQVRKAV
ENMQTYLANAGY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatggaacgcctacattgacacgatgaccgccgccgccccatcgatcaagcgt
gccgccatcgtcggagccaccgacggagccgtctgggctcgtaccgaggacgccaacgtc
ttcaaggccacggaagcggagctgaagacgttcgtcaacctgttccaagacgtgactgcc
gtgccaggaaagggagccgacattgaaggcgtgcactacgtggtgccacgctccgaggag
acgctgatcttcggaaagaaggagaacactggattctttgccgccaagaccaagtcggcc
gtcctgattgccgtctacgagggaccgaacgaggtggccgctcaggtccgcaaggctgtc
gagaacatgcagacgtacctcgccaacgctggatactaa

DBGET integrated database retrieval system