KEGG   Caenorhabditis briggsae: CBG04612Help
Entry
CBG04612          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG04612
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00010  Glycolysis / Gluconeogenesis
cbr00020  Citrate cycle (TCA cycle)
cbr00620  Pyruvate metabolism
cbr01100  Metabolic pathways
cbr01200  Carbon metabolism
Module
cbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG04612
   00020 Citrate cycle (TCA cycle)
    CBG04612
   00620 Pyruvate metabolism
    CBG04612
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBG04612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 8579820
NCBI-ProteinID: XP_002637823
WormBase: CBG04612
UniProt: A8WY22
Position
V
AA seq 507 aa AA seqDB search
MSKFPVPLRTIGGLRPSATAAISAANIGFTQSSRALNTSTKSSALVGQVARQYPNAAAFS
IKQVRLYSSNNLPKHNRVALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMG
FETPEEGYLAKILIQEGSKDVPIGKLLCIIVENEADVAAFKDFKDDGAAAGGDSSAKKES
APEPPKQSSPPAASSPPTPMYQAPSIPKSAPIPPPSSGRVSASPFAKKLAAEQGLDLSGV
SGSGPGGRILASDLSQAPAKGATSTTSQASSGQDYTDVPLSNMRKTIAKRLTESKSTIPH
YYLTSEIQLDTLLQVREKLNGLLAKGTSGHATKISINDFIIKASALACRRVPEANSYWMD
SFIRENHHVDVSVAVSTAAGLITPIVFNAHAKGLATIASEVTELAQRAREGKLQPHEFQG
GTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLIPDEAEGYKKIKTMKVTLSCDH
RTVDGAVGAVWLRHFKEFLEKPHTMLL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcccggtgccgttgagaacgattggtgggctccgtccatcggccaccgcc
gccatttcagcggccaatatcggtttcacacaatcgagccgcgccttgaacacctctacg
aagagctccgctctcgttggacaagttgctcgccaatacccaaatgcggccgctttcagc
attaagcaggttcgcctttacagcagcaacaacctgccaaagcacaaccgagtagctctc
ccagcgctgtcgccaactatggaactcggaactgttgtcagttggcaaaagaaagaagga
gatcagctcagcgagggagatttgctctgcgaaattgaaaccgacaaggccactatggga
ttcgaaactccagaagagggatatttggccaagattttgattcaagaaggatcgaaagac
gttccaattggaaaacttctctgtatcattgttgaaaatgaagccgatgtcgctgctttc
aaagacttcaaggatgatggagctgccgccggaggagattcatccgctaagaaagaatct
gctcctgaaccaccaaagcaatcctccccaccagctgcttcttctccaccaactccaatg
taccaggctccatctatcccaaagtctgctccaattccaccaccatcatccggaagagtt
tccgcttctccattcgcaaagaaacttgccgctgagcaaggactcgacttgagcggtgtt
tctggaagtggaccaggaggaagaattcttgcttccgacctttcgcaagctccagctaaa
ggagctacatcaacgacaagccaggcgtcttctggccaagattacactgatgttccattg
tcaaatatgagaaagactattgctaagagactcactgagagcaagtcgacgattccacat
tattatcttactagtgaaattcaattggatactcttcttcaagttcgtgagaaactcaac
ggtcttctcgcgaagggaacatctggacatgctaccaaaatttccatcaacgacttcatc
atcaaggcatctgctcttgcctgccgacgtgttccagaagccaacagctactggatggac
tccttcatccgtgagaaccatcacgtcgacgtctcagtggccgtcagcactgcagccggt
ttgatcactccaatcgtcttcaatgctcacgccaagggactcgccactattgcctccgaa
gttaccgagttggcacagagagctcgtgaaggaaagttgcagccacacgaattccaagga
ggtactttcactgtctccaacctcggaatgttcggatcggtctctgacttcactgctatt
atcaacccaccacaatcatgcattttggccattggaggagcttccgacaaactgattcca
gatgaagctgaaggatacaagaagatcaagaccatgaaggtgacactgtcatgcgatcac
cgaactgtcgacggagctgttggagccgtctggcttcgtcacttcaaggagttcctcgag
aagccacacaccatgcttctctaa

DBGET integrated database retrieval system