KEGG   Caenorhabditis briggsae: CBG04747Help
Entry
CBG04747          CDS       T01054                                 

Definition
Hypothetical protein CBG04747
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
cbr  Caenorhabditis briggsae
Brite
Ribosome [BR:cbr03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    CBG04747
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 240 aa AA seqDB search
MLATGGTIARRLIHSSCRLACEGKTKEVPTPEEAGYAFNHVERKKGMYKPQHSIAEQVSY
MKSRAYAEAYKGLPIYRWYKRNIKFSGQSKLQPPPRLFCIDKHGRFNLNHACPVCRDEYL
YFDYRNPSLIEQFLADGTDQPIDILKSGLCREQYTLLRAQLLKAKEHGTIPFGVEFRNFD
YRQWYKSWTEEPGKPVERAGVRLQDIHPDPLVHFPTFKNDKNNDWDQWWIRHDKFAKKAK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttggctaccggtggaaccatcgcaagacggctaatccactcgtcgtgccgattggcg
tgtgaaggaaaaacgaaagaagttccgactccagaagaggctggctacgctttcaatcat
gtcgaacgaaaaaagggaatgtacaagccacaacacagtatcgcagaacaagtttcctac
atgaaaagtcgagcatatgccgaagcttacaaaggacttccgatctacagatggtataag
agaaatatcaagttttcagggcaatcaaaactgcaaccaccgccaagactcttctgcatt
gataaacacggacggttcaatttgaatcatgcgtgtccagtttgccgtgacgagtacctc
tactttgactaccgcaacccatcgctcatcgaacaattcctcgcagacggcaccgatcag
ccaatcgatattctgaaatccggattgtgccgcgagcagtacaccctgctccgcgcacaa
cttctaaaggccaaggaacacggaacgatccctttcggagtggaattccgaaatttcgac
tatcgtcaatggtacaaaagttggacagaggagccggggaagccagtggagagagcaggt
gtacgtcttcaagacattcatccggatccgttggttcatttcccaacgttcaaaaatgac
aagaataatgactgggatcagtggtggattcgacatgacaagtttgcaaagaaagctaaa
taa

DBGET integrated database retrieval system