KEGG   Caenorhabditis briggsae: CBG04814Help
Entry
CBG04814          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG04814
  KO
K17610  calcineurin B homologous protein 1
Organism
cbr  Caenorhabditis briggsae
Brite
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CBG04814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_11 EF-hand_4 Phage_portal_2 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 8579988
NCBI-ProteinID: XP_002637991
WormBase: CBG04814
UniProt: A8WYJ2
Position
V
AA seq 199 aa AA seqDB search
MGNNRSLMSEEEVKEIMDETDFNRNQIIRLHSRFQSLDKKGQGYLSREDFQNVPELAVNP
LGDRIVDAFFSLDSSSFGYKLAKNEEQKLNFRQFVRILAHFQPMSKVKKNSLNSRRDKLL
FAFKMYDLNKNNYITREEFKTILNSMVGANITPDQLEKIADRTMKEADADNDGRISFEDF
CRAMEKTDIEEKMSIRFMN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaaccgatcgctgatgagtgaagaggaggtcaaggaaattatggatgagacc
gatttcaacagaaatcagatcattcgtcttcacagcagattccagtcgctcgacaagaaa
ggccaaggatatctatcccgcgaggacttccagaatgttccagagctggctgtgaatccc
ttgggtgatagaatcgtcgacgcgttcttttccttggattcgtcgtcgtttggatataag
ttagcaaaaaatgaggagcagaaattgaatttccgtcagtttgtgaggattctagcgcat
tttcaaccaatgtcaaaagtcaagaagaatagtttgaattccagaagagacaagttgcta
tttgccttcaaaatgtacgacctgaacaaaaacaattacatcactcgcgaagagttcaaa
accattttgaacagtatggttggcgccaatattacaccggatcagttggaaaagattgct
gatcgaacaatgaaagaggcagatgccgataacgatggtcgcatttcgtttgaagacttt
tgtagagcaatggagaagacggatattgaggagaagatgtcgattcgattcatgaattga

DBGET integrated database retrieval system