KEGG   Caenorhabditis briggsae: CBG04814Help
Entry
CBG04814          CDS       T01054                                 

Definition
Hypothetical protein CBG04814
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cbr  Caenorhabditis briggsae
Brite
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CBG04814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 199 aa AA seqDB search
MGNNRSLMSEEEVKEIMDETDFNRNQIIRLHSRFQSLDKKGQGYLSREDFQNVPELAVNP
LGDRIVDAFFSLDSSSFGYKLAKNEEQKLNFRQFVRILAHFQPMSKVKKNSLNSRRDKLL
FAFKMYDLNKNNYITREEFKTILNSMVGANITPDQLEKIADRTMKEADADNDGRISFEDF
CRAMEKTDIEEKMSIRFMN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaaccgatcgctgatgagtgaagaggaggtcaaggaaattatggatgagacc
gatttcaacagaaatcagatcattcgtcttcacagcagattccagtcgctcgacaagaaa
ggccaaggatatctatcccgcgaggacttccagaatgttccagagctggctgtgaatccc
ttgggtgatagaatcgtcgacgcgttcttttccttggattcgtcgtcgtttggatataag
ttagcaaaaaatgaggagcagaaattgaatttccgtcagtttgtgaggattctagcgcat
tttcaaccaatgtcaaaagtcaagaagaatagtttgaattccagaagagacaagttgcta
tttgccttcaaaatgtacgacctgaacaaaaacaattacatcactcgcgaagagttcaaa
accattttgaacagtatggttggcgccaatattacaccggatcagttggaaaagattgct
gatcgaacaatgaaagaggcagatgccgataacgatggtcgcatttcgtttgaagacttt
tgtagagcaatggagaagacggatattgaggagaagatgtcgattcgattcatgaattga

DBGET integrated database retrieval system