KEGG   Caenorhabditis briggsae: CBG05010Help
Entry
CBG05010          CDS       T01054                                 

Definition
Hypothetical protein CBG05010
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cbr  Caenorhabditis briggsae
Pathway
Polyketide sugar unit biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CBG05010
Enzymes [BR:cbr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CBG05010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 190 aa AA seqDB search
MSVPTPGKRFQLEKEVVAAIPDLLVIKPKVFPDERGFFSESYNKTEWAEKIGYTEDLQQD
NHSFSHYGVLRGLHTQPHMGKLVTVVSGEIFDVAVDIRKDSPTYGKWHGVILNGDNKHAF
WIPAGFLHGFQVLSKEGAHVTYKCSAVYDPKTEFGINPFDEDINVDWPIKDKASVIVSER
DTQHASFKSL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttccaacaccaggaaaacgtttccaacttgagaaggaagtcgtcgcggctatt
ccagatcttcttgtcatcaagccaaaggtgttcccagacgagcgtggattcttctccgag
agttacaacaaaaccgagtgggctgaaaagattggttacaccgaggatcttcaacaggat
aatcactccttctcccattacggtgttctccgtggtctccacactcaaccacacatggga
aaattagttactgtggttagcggagaaatcttcgatgtggctgttgacatccgcaaggac
agcccaacctacggaaagtggcatggagtgattttgaatggagataacaagcacgccttc
tggattccagctggattccttcacggattccaagtgcttagcaaggaaggagctcatgtc
acctacaagtgctccgctgtctatgacccaaagactgaatttggaatcaacccattcgac
gaggatatcaatgtggactggccaatcaaagacaaagcttccgtgattgtttcggaacgc
gacacccagcatgcctctttcaaatctctctaa

DBGET integrated database retrieval system