KEGG   Caenorhabditis briggsae: CBG05381Help
Entry
CBG05381          CDS       T01054                                 

Definition
Hypothetical protein CBG05381
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG05381
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG05381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 899 aa AA seqDB search
MPTPEDVPMDDHENVEVAEKSNEHSPTREDLQKLLQRVERASLKENESWFLISQKWWNAF
VKSVRDGFIEDAGPIDNSQISECRQGVFYLKQRLAEQIDYTTIPEDCFKELVRYFGVDDE
RRDYIERQVIKKNNSLSVDVYPRIIYIALARNRAMKVELILKPEDTMVTLRDRVIQELNL
NESDSIRFYVMNDENPELIDTTQSIDSYFDTVQKVLVDVEENGEFFFKNKNPTQPQSKSL
FGNQSSSLGGNGNGASNSYSYSSSSAHRTTPGACGLSNLGNTCFMASALQCLSNVPPLRD
YFLNNKYTEDINDENPLGTRGNLALAVGELMKGMWSGEYSSINPRKFKGIIGQFAPRFNG
YTQQDAHELMAYMLDGLHEDLNRVKQKPYIQDNDEDQKLPEAEYAAKSWHSYKLRNDSII
VDLMHGQLRSTLVCPVCDTVSIKFDPFGYISLPLPAKEQIVRQTVIVMFLERKWAKFSLG
ITDTTTVEDAERLMLEKLQPEKKHHFVFFHVPSQYHDDITVLRPSDKVRVPGREVYVAEV
EHDLSVKGTRIFVAYNRIKLLRPASLPMIYSLPPGDVLTRGFLNDHVFATTKKFFINQKI
SVDVAANSNDEDSMNGSNSADEREPYKLFAGPPGTQTPLPIPPTDEPIAFPNENSHDVYH
NFLQISFQWKDSKLFNNYKGLDLIEREMTVSTRRKVFLEETLDWYTKKEQLGEQDSWYCP
KCKKHERATKQLDMWKLPEILVLHLKRFQYTKWSREKLTWEVVIPVRGLDLTNKIVNPNH
EKAIYDLIAVSRHYGSMSGGHYTAAAFNDHAQKWYDFNDSSASATYPPTDPYESSDPYIL
VYRRRPLDSRGEPLEPETTAIASQARPKRGAAPSISSATTSSASSSRHQVDENMEMEED
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacctgaagatgttccaatggacgatcatgaaaatgtagaagttgctgagaaa
tcgaatgagcattcgccgacccgtgaggatctgcagaaacttcttcagcgagtggaaaga
gcttctttaaaggaaaacgaatcttggttcttgatcagccaaaaatggtggaacgccttc
gttaaatcagttcgagatggatttatcgaagatgccggacctatcgataattcgcaaata
tctgaatgtcgccaaggagtgttttacctgaaacagaggcttgccgagcaaatagactac
accaccattccggaggattgtttcaaagaacttgttcgttacttcggcgtagacgatgaa
cgtcgtgattatatcgagcgtcaggttatcaagaagaacaacagcttatctgtcgatgtg
tatccccgaatcatttacattgcgctggcgagaaacagagctatgaaagttgaactgatt
ctgaaaccggaggataccatggtgacgcttcgagatcgagtgattcaagaacttaacctc
aacgaaagcgacagtatcagattttacgtcatgaatgatgagaatcctgagctcattgac
actacccaatccattgacagttattttgatactgttcaaaaggtgctggtcgacgttgaa
gagaacggagagttctttttcaagaataaaaaccctacgcaaccacagtcgaaatcctta
tttggaaaccaatcttcctcacttggtggaaatggaaacggtgcatcaaactcgtattca
tattcttctagcagcgcccaccgtactacccctggtgcttgtggattgtcaaatctcgga
aatacatgtttcatggcatctgcactccaatgtttgagcaatgtgcctcctctgcgtgat
tatttccttaacaataaatacactgaggatattaacgatgagaatccgctggggacgagg
ggaaatctggctttggctgtcggagagctgatgaagggaatgtggagtggtgaatactct
tccataaatcctcgtaaattcaaaggaatcattggacagtttgctccacgattcaacggt
tacacgcagcaagacgcacacgagctgatggcctacatgcttgatggccttcacgaagac
ttgaatcgtgtgaaacagaagccttatatccaagataatgacgaggatcaaaagcttcca
gaggctgagtatgctgccaaatcatggcactcgtataaactacgaaacgattctatcatc
gttgaccttatgcacggccagctcagatcgacattggtttgtccggtttgcgataccgtc
tcgatcaaattcgatccgtttggatacatttccctacctcttcccgccaaagaacaaata
gtgaggcagacggttatcgtcatgtttctggaacgaaaatgggccaagttctcgttggga
ataacagatactacgactgtcgaagacgccgagagattgatgctggaaaaattacaacca
gagaagaagcatcattttgtcttcttccatgttcccagccaatatcatgatgatattacc
gttctcaggccaagtgataaggtcagagttccaggtcgggaggtttatgtagcggaagtt
gagcatgatctgtcggtgaaaggaacacgtattttcgttgcatacaaccgtatcaaactg
cttcgccccgcctctttgccaatgatctattctcttccaccaggcgacgtattgacacgt
ggatttttgaatgaccatgttttcgcaacaacgaaaaagttcttcattaaccagaagatc
tctgtggatgtggctgcaaattcaaatgatgaggattcgatgaatggcagtaactcagct
gacgagcgtgagccatacaaactttttgccggaccaccaggtacacaaactcctcttccg
attcctccaaccgacgaaccaatcgcgtttcctaacgaaaattcgcatgacgtctatcat
aatttcttgcaaatcagcttccaatggaaagattcaaaactgttcaacaactacaaaggg
ttggatttgatagaacgcgagatgaccgtttccactcgtagaaaagtctttctcgaagaa
actctggattggtacacgaagaaagagcaattaggagagcaggattcgtggtactgtcca
aagtgtaaaaaacacgaaagagcaacgaagcaattggatatgtggaaattgcctgagatt
cttgtgctgcatctgaagagattccaatataccaagtggtctcgcgagaagctgacatgg
gaggtcgtcattcctgtgcggggactcgatttgaccaataaaattgttaatccaaaccac
gagaaagcaatttatgacttaatcgccgtatctcgtcattatggatcgatgagcggagga
cattatacagccgcagcgttcaatgatcatgcacaaaaatggtatgacttcaacgactcg
agtgctagtgctacttacccaccaactgatccatacgagtcgtctgacccttacatactc
gtctacagacgacggccgttagattccagaggagaacctcttgagcctgagacaactgct
attgcatcccaagctcgcccgaaacgaggagccgctccatccatttcatcagctacgaca
tcgtcagcttcttcatctcgccatcaagttgatgaaaatatggagatggaggaagattga

DBGET integrated database retrieval system