KEGG   Caenorhabditis briggsae: CBG05585Help
Entry
CBG05585          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG05585
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Pathway
Mitophagy - animal
Endocytosis
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CBG05585
   04137 Mitophagy - animal
    CBG05585
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG05585
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG05585
Membrane trafficking [BR:cbr04131]
 Endosome - Lysosome transport
  Others
   Others
    CBG05585
Ubiquitin system [BR:cbr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CBG05585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Position
V
AA seq 357 aa AA seqDB search
MTMAIDRSIDERTKSRGAGLPGAVGLYNMGNTCFMSATLQCLFQTPGLPEVFTRRNFVSQ
LNTQNTYGSKGVISAGFASLLDTIWTGPFQAIRPARFLQLFADEVYRNLNDGRQHDASEF
QLFLLDALHEDTNQGKRISFEQNYKGGQGIRQEAADFLRKHYQFTMSPVNRILGTITVAE
VRCLTCGESSATFEENTIVSVEITSNTSCTLDNCLRSHFSQTKLEGDSAWNCPKCKTPRT
STRTSKLWQPPPVLVIHLKRFALFYGDFEKNTASVAFDAARFDIRPYLHEAAPTDKPFYK
LYAATLHNGRLNSGHYTSVASHLRNDKWHRYDDETVTPCEKFQVNPQLAYILFYKRC
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcaatcgatcgatccatcgacgagcggaccaaatcccgaggagccggtctg
ccgggcgccgtcggcttgtacaacatgggaaacacgtgtttcatgtccgccacgttgcag
tgtctattccagacgcccggacttccagaagtgttcaccaggaggaactttgtatcccag
ctgaacactcagaacacgtacggatcgaaaggagtcatttccgctggattcgcctcgctt
ctagacacaatttggacgggaccattccaggcgattcgtcccgcccgtttcctccagttg
tttgctgatgaagtgtaccggaatctgaacgatggacgacaacacgacgcgtcggaattc
cagctgttcttgttggacgcactgcatgaggatacgaatcagggcaaacggatttcattc
gagcagaactacaaaggcggtcaagggatacgacaggaggcggcggactttttgagaaag
cactatcagttcacaatgtcgccagtcaatcggattttggggacgattacggtagctgag
gttcgatgcttgacgtgtggcgagtcatcggcgacgttcgaagagaatacgattgtgtca
gtggagatcacttcgaatacatcgtgcacactggacaattgccttcgatcccatttctca
cagaccaaactagaaggtgactcggcctggaactgtccgaagtgcaaaacgcctcgtacc
agtacccgaacatcgaagctgtggcaaccaccgccggttcttgtgatccatctgaagcgg
ttcgctctgttctacggggattttgagaagaatacagcgtcggtggcgtttgatgccgct
cgtttcgatattcgtccctatttgcatgaggcggcgccgacggataagccattttataag
ttgtatgcggctacgctccacaacggtcgcctcaattccggtcactacacttcggtcgcc
tctcatctccgcaacgacaaatggcatcgatacgacgatgaaaccgtcacgccttgtgag
aaattccaagtcaacccgcagctggcctacatccttttctataaacggtgctag

DBGET integrated database retrieval system