KEGG   Caenorhabditis briggsae: CBG05733Help
Entry
CBG05733          CDS       T01054                                 

Gene name
Cbr-jnk-1
Definition
C. briggsae CBR-JNK-1 protein
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cbr04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cbr04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cbr04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cbr04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 464 aa AA seqDB search
MEERLSTTSSYPSHPGKSVEEDHNSLLASSSISSLIRGTRGHLNNFIESVGNWLVPSSSG
RDDDVVSLDSCQSAYSPVRHQYNSGIGGGGHLMEPSSIHVPDNYYSVTIGEAQMVVLKRY
QNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNII
GILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAG
IIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENV
DVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRY
QPTPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFD
EIEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgattatccacgacgtcgtcatatccatctcatccaggcaaaagcgtggaa
gaggatcacaactccttgcttgcttcatcctcaatatcctcattgattcgaggaacacgg
ggacacctcaacaattttatagaatccgttggaaactggctggtcccatcatcatctggc
cgtgacgacgacgttgtctctctggacagttgtcaatcagcttatagccccgtccgtcat
caatataacagtggtattggaggaggaggtcatctgatggaaccctcctccattcatgtt
cccgataattattattcggtgacaataggggaggcgcagatggtcgttctaaaacggtac
caaaatctcaggttgatcgggtctggtgcgcagggaatcgtctgctcggcattcgataca
gtacgaaatgaacaagtagcgattaagaaactttcaaggccatttcaaaatgtaacacat
gcaaaaagagcttatcgagagctgaagttgatgagtcttgttaatcataaaaatataata
ggaatcctgaattgttttactccacaaaaaaaactcgacgagttcaacgatctctacatc
gtaatggaattaatggatgcaaatttgtgtcaagtgattcaaatggatttggatcacgag
agattatcatatcttctttatcaaatgttatgtggtatcaggcatcttcatagtgctgga
attatacatagggatttgaaaccatccaacattgtcgttcggagtgattgtaccttgaag
attttggacttcggattagctcgaacagcaatcgaagcattcatgatgaccccatacgtt
gttacacggtactatcgggcaccggaagttattcttggaatgggatataaagaaaatgtg
gacgtttggtcaattggatgtatattcggagaattgattcgtggacgagtactgtttccg
ggtggagatcatatcgatcaatggacgaggataatagaacaattgggtacaccagaccgt
tcgtttttggagaggttacagccaacagtccgaaattatgtagagaaccgaccgagatat
caaccaacaccattcgaagttctgttcagtgataacatgttcccgatgaccgctgatagt
tcaaggctaacaggtgcccaagcccgtgacctactttcccgaatgttggttatcgaccca
gaaagacggatttctgtggatgatgctttaagacatccttatgtgaatgtatggtttgat
gaaattgaggtctacgcacctccaccactaccctatgatcacaatatggatgtagaacaa
aacgtggattcgtggagagagcacatcttcagagagctgactgattacgcacggacccat
gacatctattcatga

DBGET integrated database retrieval system