KEGG   Caenorhabditis briggsae: CBG05733Help
Entry
CBG05733          CDS       T01054                                 

Gene name
Cbr-jnk-1
Definition
(RefSeq) C. briggsae CBR-JNK-1 protein
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Insulin resistance
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CBG05733 (Cbr-jnk-1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG05733 (Cbr-jnk-1)
   04012 ErbB signaling pathway
    CBG05733 (Cbr-jnk-1)
   04310 Wnt signaling pathway
    CBG05733 (Cbr-jnk-1)
   04068 FoxO signaling pathway
    CBG05733 (Cbr-jnk-1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    CBG05733 (Cbr-jnk-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CBG05733 (Cbr-jnk-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CBG05733 (Cbr-jnk-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 464 aa AA seqDB search
MEERLSTTSSYPSHPGKSVEEDHNSLLASSSISSLIRGTRGHLNNFIESVGNWLVPSSSG
RDDDVVSLDSCQSAYSPVRHQYNSGIGGGGHLMEPSSIHVPDNYYSVTIGEAQMVVLKRY
QNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNII
GILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAG
IIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENV
DVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRY
QPTPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFD
EIEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgattatccacgacgtcgtcatatccatctcatccaggcaaaagcgtggaa
gaggatcacaactccttgcttgcttcatcctcaatatcctcattgattcgaggaacacgg
ggacacctcaacaattttatagaatccgttggaaactggctggtcccatcatcatctggc
cgtgacgacgacgttgtctctctggacagttgtcaatcagcttatagccccgtccgtcat
caatataacagtggtattggaggaggaggtcatctgatggaaccctcctccattcatgtt
cccgataattattattcggtgacaataggggaggcgcagatggtcgttctaaaacggtac
caaaatctcaggttgatcgggtctggtgcgcagggaatcgtctgctcggcattcgataca
gtacgaaatgaacaagtagcgattaagaaactttcaaggccatttcaaaatgtaacacat
gcaaaaagagcttatcgagagctgaagttgatgagtcttgttaatcataaaaatataata
ggaatcctgaattgttttactccacaaaaaaaactcgacgagttcaacgatctctacatc
gtaatggaattaatggatgcaaatttgtgtcaagtgattcaaatggatttggatcacgag
agattatcatatcttctttatcaaatgttatgtggtatcaggcatcttcatagtgctgga
attatacatagggatttgaaaccatccaacattgtcgttcggagtgattgtaccttgaag
attttggacttcggattagctcgaacagcaatcgaagcattcatgatgaccccatacgtt
gttacacggtactatcgggcaccggaagttattcttggaatgggatataaagaaaatgtg
gacgtttggtcaattggatgtatattcggagaattgattcgtggacgagtactgtttccg
ggtggagatcatatcgatcaatggacgaggataatagaacaattgggtacaccagaccgt
tcgtttttggagaggttacagccaacagtccgaaattatgtagagaaccgaccgagatat
caaccaacaccattcgaagttctgttcagtgataacatgttcccgatgaccgctgatagt
tcaaggctaacaggtgcccaagcccgtgacctactttcccgaatgttggttatcgaccca
gaaagacggatttctgtggatgatgctttaagacatccttatgtgaatgtatggtttgat
gaaattgaggtctacgcacctccaccactaccctatgatcacaatatggatgtagaacaa
aacgtggattcgtggagagagcacatcttcagagagctgactgattacgcacggacccat
gacatctattcatga

DBGET integrated database retrieval system