KEGG   Caenorhabditis briggsae: CBG05884Help
Entry
CBG05884          CDS       T01054                                 

Definition
Hypothetical protein CBG05884
Orthology
K11252  
histone H2B
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRAHRKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatccgccaagggagccaagaaggccgctaagaccgtcaccaagcca
aaggatggaaagaagagaagagcccaccgcaaggaatcgtactctgtctacatctaccgt
gtcctcaagcaagttcacccagacactggagtctcctccaaagccatgtctatcatgaac
tcgtttgtcaatgacgtcttcgagcgcatcgctgctgaggcctctcgtcttgcgcactac
aacaagcgttctaccatctcttctcgcgaaatccagacagccgtccgtctgattcttcca
ggagagcttgccaaacacgccgtgtctgaaggaaccaaggccgtcaccaagtacacttcc
agcaagtaa

DBGET integrated database retrieval system