KEGG   Caenorhabditis briggsae: CBG05896Help
Entry
CBG05896          CDS       T01054                                 

Gene name
Cbr-plc-4
Definition
C. briggsae CBR-PLC-4 protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG05896 (Cbr-plc-4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    CBG05896 (Cbr-plc-4)
   04070 Phosphatidylinositol signaling system
    CBG05896 (Cbr-plc-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CBG05896 (Cbr-plc-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 752 aa AA seqDB search
MANKNVSPEEQAAAQAADEEKTKEELEWAEKGSLLCRIKNQKVKEMSLVTIKSKQFLNYY
SSYWFNFVPNALKSVALSELLEVRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSHAKF
LHKSVDFCADSKETRDKWVSVLTHLISVAKHQRVVFNETAWLIDKFQQADTNKNGLLSFD
EVWNLLKRMNLQISERYAKAIFRESELEDSRDNKLNEKEFLNFFERLTDRPDLRFVMTQA
SSDNVETLTVADLQRFLTEEQGFEKVDLKKAEQILDTFEQTVQDKQKEKLMGLMGMRRLM
QSRWGNVFKPGHESIFQDMDQPLTHYFVNSSHNTYLTGLQVKGEATVEGYISALRKGARL
LELDLFDGEHGEPVITHKRTFIESITLRNSLEAIKRTAFETSPYPVILTLENHVGFVQQT
VMAELFKEILGDSLYIPPKDSHRHPLPSPNKLKRKFLLRGKKIILEEDIEEPDEDDSPTD
KDKHHVHPHPVSPELSALIGLPSVKLSHNIYQDVHKHPFDGSPSLSENKVYTMFEAAVPI
FTYTAERLVKSYPKGLRQDSSNMHPIVSWLCGIQSVAMNFQTAGEELDLNAGLFRSNGNC
GYVLKPGCLLDGVDPRSMSKPKMKLGIGLFSAQYLPKSEPGKEIIDPYVSVQIFGIPRDE
TKAKTRIIKDNGFNPEWRDNFYFTLCCPELAILRFCVKDFDSTSSNDFVGEFSIPVMSLR
TGYSQIQLNTGYQHTLDPSASLFVRIAIEEEY
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagaacgtctctccagaagagcaggctgctgcacaagctgcagatgaagaa
aaaaccaaagaagaattagaatgggccgagaaaggatcattattatgcaggattaaaaat
caaaaagtgaaggagatgtctttagtgactatcaaaagcaaacaattcctcaactactat
tcaagttactggttcaattttgttccgaatgcactgaaatccgttgcgttgtctgaacta
ctcgaagttcgatctggctatcaaaccgataatttgcaaagagcgtcgaaaaagtacgaa
tttcaagagttggcaccagaatcaagatgcttctctgttatcttttcccatgctaaattc
ctacacaagtcggttgatttttgtgccgattccaaagaaacgcgcgacaaatgggtttcc
gtactaactcatctcatatcagttgccaaacatcaacgagtcgtcttcaacgaaactgct
tggctgattgacaaattccagcaagcagacaccaacaaaaatggtcttctttcattcgat
gaagtttggaatcttctcaaaagaatgaatcttcaaatcagtgaaagatatgcaaaagca
atcttcagggagtcagaattggaagattcaagggataacaaattgaatgaaaaagaattt
ctcaattttttcgaacgactgacagaccgtccagatcttcgttttgtgatgacgcaagct
agttctgataatgtggaaacgttaactgtcgcagatttgcaaaggtttctaacagaagaa
caaggttttgaaaaagttgatctgaagaaagccgagcaaatccttgataccttcgaacaa
accgtgcaagacaaacaaaaggaaaagttgatgggtctgatgggaatgcggagattgatg
caatccagatggggaaatgtattcaagccagggcatgaaagtatcttccaagatatggat
caaccactcacccactactttgtcaattcatcacataacacatatttgacggggttgcaa
gtgaaaggagaagcgacagtggaaggctacatttctgcgttgaggaagggagcaagacta
ctggagttagatttgtttgatggtgagcatggagagccagtcatcactcataaaaggaca
ttcattgagtcaatcacactgagaaactcattagaagctatcaagagaacagccttcgaa
acatctccgtatcctgtgatcttgactctcgaaaaccacgttggattcgtgcagcaaaca
gtaatggcggaattgttcaaagaaattcttggagattctctatacattccacccaaagat
tcacatcgtcatccattgccatcaccaaacaaactcaaacgaaaattccttttgcgcgga
aagaaaatcattttggaagaagatattgaggaaccggatgaggacgactcaccaactgat
aaggacaagcatcatgtccatcctcatccagtttctcctgaactctcggctctaattgga
ttgccatctgtgaaattgagtcataacatctatcaagatgttcacaaacacccattcgat
ggaagtccttctctgtccgagaacaaagtttacaccatgttcgaggctgctgtcccaata
ttcacatacactgcagaacggctggtgaagagttatccaaaaggcttgcgtcaagattct
tccaatatgcatccgatcgtttcgtggttgtgtggaattcaaagtgttgctatgaacttt
caaactgctggagaagaattagatctgaatgcaggattgttcagaagcaatggtaattgt
ggttatgttttaaaaccagggtgtttgctggatggagttgatccaagaagtatgtcaaaa
ccaaagatgaagcttggcattggtcttttctcggcgcaatatcttccaaaatcagagcct
ggaaaggagatcattgatccatatgttagtgttcaaatctttggaattccacgtgacgaa
acaaaggcaaagaccagaatcatcaaggataatggattcaatccagaatggagagacaat
ttctattttacgctctgttgcccagagcttgccattcttcgattctgcgtgaaagacttc
gattctacttcatccaacgatttcgtcggggagttttcaattccagtgatgagtcttcgc
accggttattcccagattcagttgaacactggatatcaacacactttggatccatctgca
tccctttttgtcagaattgcaatcgaggaggaatattga

DBGET integrated database retrieval system