KEGG   Caenorhabditis briggsae: CBG05984Help
Entry
CBG05984          CDS       T01054                                 

Gene name
Cbr-alh-3
Definition
C. briggsae CBR-ALH-3 protein
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cbr  Caenorhabditis briggsae
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CBG05984 (Cbr-alh-3)
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     CBG05984 (Cbr-alh-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 908 aa AA seqDB search
MKIAIIGQSAFGVDVYKELRKNGHEIVVVFTIPDKNGREDLLAVEAAKDGVPVQKPARWR
KKNPETGKFETLPEMLELYKSFGAELNVLPFCTQFIPLEITEAPPKKSIIYHPSILPKHR
GASAINWTLIEGDEEAGLSIFWADDGLDTGPILLQKKCKVEENDTLNTLYKRFLYPAGVA
AVAESVELIASGNAPRIVQPEEGASYEPYITTKPELAQIDWSKTQRQLHNFIRGNDKVPG
AWSIFNGERVSFFGSKLWKPKKLPEDAVEVAVAEVPGGKVLVEDRGLLLPGSDGKWVIVD
TVKIGTKTIPASKYGQGADQVEELVLTDDEKNVVTKLKKIWAGILKTQVSSDTDFFESGA
SSADVTRLVEEIKFNTGAELESGHIYSGPTLGENIDIVVRNLRGEGGLSVTYDPIVLNVN
NMELKFPHEQFIDGKFVGSSDGRTFQTINPATEKPICSLPLATVADVDRAVRAAKKAFER
GEWRQMSARERGKRLYRLAELMEEHKEELATLESLDAGAVYTLALKTHVGMSIDVWRYFA
GWCDKIQGKTIPISNARPNKNLCLTVREPIGVVGLITPWNYPLMMLSWKMAACLAAGNTV
VHKPAQVTPLTALKFAELSVLAGIPPGVINIVTGSGSLVGNRLTAHPDVRKIGFTGSTEI
GATVMESCAKSNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVF
IAKSIHDSFVKKLVEEAKQYKIGDPLDRSTAHGPQNHLAHLNKLVEYVENAVRDGAKVEV
GGKRLEREGLFFPPTILSNIDDENFAASEESFGPIMCISSFDDDDVEDVLRRANDTEFGL
AAGVFTRDASKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLV
TKTITIEY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctattatcggccaatcggccttcggagtcgatgtgtacaaagagctccgt
aaaaatggtcatgaaatcgtggtagtcttcactatcccagataaaaatggaagagaggat
cttttagctgttgaagctgcaaaggatggagttccagtccaaaagccagctcgttggcgc
aagaagaaccctgaaactggaaagtttgaaacacttcccgagatgcttgaactctacaaa
tcattcggtgccgagctcaatgtacttccattctgtactcaattcattccactggaaatc
accgaggcaccaccaaaaaagagtatcatttatcatccgagtatcttgccaaagcacaga
ggagcttctgctatcaattggactctgattgaaggagatgaagaagctggtctttcgatc
ttctgggctgatgatggacttgatactggaccaattttgttgcagaagaaatgcaaagtt
gaggaaaatgatactctgaacacgctgtataagagattcttgtatcctgcaggagtcgca
gctgtggccgagtctgtcgagctgattgcctctggaaatgccccacgtattgttcaacca
gaagaaggagcttcttatgaaccatacattaccacgaaaccagaacttgctcaaatcgat
tggtccaaaacccaacgacaactgcataacttcattcgcggaaatgacaaagttcctgga
gcatggtccatttttaatggagaaagagtttcattcttcggatcgaagttgtggaagcca
aagaagctcccagaggacgctgttgaagttgcggtggctgaagttccaggaggaaaagtt
cttgttgaagatcgtgggcttttgcttccaggctcagatggaaagtgggttatcgtggac
actgtgaagattggaacaaagactattcctgcttcaaagtatggtcaaggtgccgatcaa
gtggaagaattggttctgactgacgatgagaagaacgttgttactaaactcaagaaaatc
tgggctggaattctgaaaacacaagtttctagtgatactgatttctttgaaagtggagcc
agctctgctgatgttactcgtcttgttgaggagataaaattcaacacgggagctgaactt
gaatcaggacatatctattctggaccaactcttggggagaacattgacatcgtggtccgt
aatctccgaggagaaggtggactcagcgttacctatgatccaattgttttaaatgtcaat
aacatggaattgaagtttccacatgagcaatttatcgatggaaaattcgttggatcttct
gatggacgcacattccaaaccatcaatccagcaaccgagaagccgatttgctcccttcct
ctagctactgtagctgacgtcgatcgagctgttcgtgctgccaagaaagcttttgaacgt
ggagaatggcgtcagatgtccgctcgtgaacgaggaaagcgtctgtaccgtcttgcggag
cttatggaagagcataaagaagagctggctacgctggaatctttggatgctggagcagtt
tataccctggctctcaaaactcatgttggaatgtccattgatgtatggaggtattttgcc
ggatggtgtgacaagattcaaggaaaaaccatcccaatctcaaatgctcgtcctaacaaa
aatctctgtctgactgtccgtgaaccaattggagtcgtcggacttatcactccatggaac
tatccattgatgatgttgtcctggaaaatggctgcttgtctagctgctggaaacactgtc
gttcacaagccagctcaagttactccactgactgctttgaagtttgctgagctttctgtt
cttgctggaattccaccaggtgtaatcaacattgttactggttccggctctcttgttggt
aaccgtcttactgctcacccagatgtacgtaagattggattcactggatctacggaaatc
ggagcaactgtgatggaatcttgtgccaagtcgaacatcaagaaagtctctttggaactt
ggaggaaagtcgcctctcatcattttcgcagatgctgatcttgaaaaagctgtgaaacaa
gcctgtggagcagttttctttaacaagggagagaattgcattgctgctggccgtgtgttt
attgctaaatcgatccacgatagttttgtgaaaaagcttgtcgaggaagccaagcagtat
aaaattggagatcctctcgatagatccactgctcatggaccacaaaaccatttggctcat
ctgaacaagcttgttgaatatgttgagaatgctgttcgcgacggagccaaggttgaagtc
ggaggaaaacgattagaaagagagggattgttcttcccaccaactattctttccaatatt
gatgacgaaaactttgctgcaagtgaggaatcctttggacctatcatgtgcatttctagc
ttcgatgatgatgatgttgaagacgttctccgtcgcgccaacgacactgaattcggtctt
gccgctggagtctttactcgtgatgcatccaaatctcttcgtgtcgctgaagctcttcat
gctggtactgtattcgtgaatacctaccagaagaccgacgttgctgctcctttcggtgga
ttcaaacaatctggattcggaaaagacatgggagaagaggctttgaatgagtatttggtc
accaagaccattaccattgagtactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system