KEGG   Caenorhabditis briggsae: CBG06373Help
Entry
CBG06373          CDS       T01054                                 

Gene name
Cbr-egl-8
Definition
C. briggsae CBR-EGL-8 protein
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG06373 (Cbr-egl-8)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CBG06373 (Cbr-egl-8)
   04020 Calcium signaling pathway
    CBG06373 (Cbr-egl-8)
   04070 Phosphatidylinositol signaling system
    CBG06373 (Cbr-egl-8)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CBG06373 (Cbr-egl-8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 1431 aa AA seqDB search
MAKEFQFNWKPNIPPSLAQGACFDRYDDESTCLELNAQVRVDEYGFFFFWLVEGKDAVVL
DMGQIWEARPGGLPKDGRIMFELEQRGASETIAERTIWVTHGQDLVNVQSFFLVAESVEM
AKMWRTGMNEILKTSRIRHVCPTTQLLKYWKWLTLNVNERRKIPIKVIIKTFSSGKPEKM
VQKCLNDLGLGGDKYTPVRVINRSMGKKFRNFYKCSRGRKRKEREELDVEILTFEKFLRL
YNKICPRTEVQELFVKLSGQKEYLTKDRLINFLNEEQRDPRLNEILFPFFDPPRTGQLIA
KYESDNNYIENGKMSGDAFLRFLMSDENPPVFLDRIEMYMDMDQPLCHYYINSSHNTYLT
GRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLMQI
RDTAFARSDFPVILSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFDDAPLEPGVSLPSPN
RLRKKILIKNKRLKTDIERHQLDQFLREGKLDEEDELNETADVVGEDSVSPRSGGSGGTV
AAEDVAMDDDTSDDDDDPSVQTSLNVMRTVPIVSTTSNNGSNRSARSSLDTPSPSGGGLM
VPDRASSTATSIKNAVLARSPNFSSLRQKLSFKRRQSPLAGDQRAHPEVEQPNSSSSPAT
PSICGPSPIATSSASTSSITITTTGCSTSSAGVSKPNQGGEMPVKETDEAHPELKQNFIA
KNLKGFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEA
NNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQPSRIYPKGARVDSSNFLPQIFWNAGCQ
MVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSV
RVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDPFVFRKVVLP
ELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYV
PDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTKNMALRNMKQPPRQNG
SSADLLSNNTQPGSARSETTPTLGTSAIRSPNEQPAPVAVDKFKVDPIEVDDLRRDKAFA
KLLKKFQKDLDDLRKKHQKQRDSIQKQQPARRRNSSIAWIQTNVDKLITNNRRSTKKEKG
SRRSLTASVSSGCGSTSGSIPVGVCIPSGPCGSGSGAPSTPGGCGSDGTGSPATTGSPVP
HDLINNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKGQLKEQFDLLKKLMSEAQKNQMQA
LKLRLEAEGKDLKQTQTKKSMEDVKVIQLDKGIKTKAERDRRIKELNEKNLKMFVEERKR
LAMKAQKHEEQLIKRHLDQLEQLEKDFQKALEAEVGNYKEEQLAAQPTSVV
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggagtttcagttcaattggaagcccaatatacccccttcactggcacaggga
gcctgtttcgatcgctatgatgatgaaagcacatgtctggaactaaacgcacaagtacgc
gtcgacgaatacggtttctttttcttctggttagtagaaggcaaagatgcggtggtcctc
gatatgggccaaatctgggaagcccgtcccggcggactgcccaaagacggtcggatcatg
ttcgagctggaacaacgcggtgctagtgagacgatagcagagcgaacaatttgggtgaca
catggacaggatctagtgaatgttcagtcgtttttcctagtagctgaaagtgtagaaatg
gcgaaaatgtggaggacaggcatgaacgagatcctgaagacgtccagaattcgacacgtt
tgtccaacgacacagttgctgaaatactggaagtggctcactctcaacgttaatgaacgc
cgaaaaattcccatcaaagtgatcattaaaacattttcatccggcaaacccgaaaagatg
gtacaaaaatgcctgaacgatttgggtctaggtggtgataagtatacaccggttcgcgtc
atcaatcgatcaatgggcaaaaagtttcggaatttctacaaatgcagtcgaggcaggaaa
cgaaaggaacgagaagagctggatgtcgaaattttgacattcgagaagtttctgcgatta
tacaacaagatttgccctaggacagaagttcaagagttgttcgtcaaattatccggtcaa
aaagagtacctaaccaaagatcgcctgataaactttctgaatgaggaacagcgggaccct
cgactcaacgagatcctctttccatttttcgatccgccacgtactggtcaattgatagca
aagtatgagagtgacaataactacattgagaacggaaaaatgtccggtgacgcgtttctt
cgattcctgatgtctgacgagaaccctccagtatttttggatcggattgaaatgtatatg
gatatggatcaaccattatgtcactattatattaatagttcacataatacgtacttaacg
ggcagacagtatggaggaaaatcatcttcagagatttatcgacaagttttgttaagtgga
tgtaggtgtattgagttggattgctgggatggaaccggagagaataagggagaaccgatc
attactcatggaaaagcaatgtgtacggacgtgttttttaaggatgtgcttatgcaaatc
agagacaccgcgtttgcccgatcagactttcccgtcatcctctccttcgaaaatcactgt
tccaaatcgaaccagctaaaaatggccaaatattgtatggacatttttggcgacatgctg
ctatcgaaaccatttgatgacgcaccgctggaacccggagtctctttaccatcgccgaac
cggcttcgaaaaaagatcctcataaaaaacaagcgtttaaaaaccgacattgaaaggcac
cagttggatcaatttctacgagaaggaaagctagacgaggaagacgagctgaacgagact
gctgatgtcgttggagaggattcggtttcacctcgaagcggtggaagcggtggaaccgtc
gctgcagaagacgtcgccatggacgacgacacatcggacgacgacgacgatccgtcggtc
caaacctcgctgaatgtaatgcgtaccgttccaatcgttagcactacctccaacaatgga
tcaaaccgctccgcacgaagttcactggacacaccatcgccgtctggcggtggtctgatg
gtccccgatcgggcatcatcgacagcgacatctatcaaaaatgcagtgctcgcgaggtca
ccaaacttctcgtcattgagacagaaattgtctttcaagcgaagacaatctccgctagcg
ggcgatcaacgagcacatcccgaagttgagcaacccaacagctcctcctccccagccaca
ccatccatttgtggtccatccccgattgccacgtcatcagcgtcaacgtcttcgatcaca
atcacgacgacaggatgctcgacgtcgtcggcaggagtgtcaaaacctaaccaaggtggt
gaaatgccagtaaaagaaaccgacgaagcacacccggaactcaagcaaaactttattgcc
aaaaatttgaaaggatttggattttcgaaaaaacaaccggtattgacaaaagaggaagag
gagaggatatttgcggaatatcattatacaggagccaccacaaatattcatccattatta
tcgtcgctggtcaattatacacatccggtcaaattttcgggtttcgatgtggcagaagcc
aacaatctgcacttccacatgtcctccttctccgaatccactggtctcggttacctcaaa
caatcggctcccgaattcgtcaactacaacaagcgccaaccaagcagaatctatccaaaa
ggagcgcgtgtcgattcttccaattttctaccgcaaattttttggaacgctggttgccag
atggtatcactcaattttcaaacgcccgatgtctacatgcagttgaatatgggaaagttt
gaatacaacggtggatctgggtatcttctgaaaccagattttctacgaagacctgacagg
acattcgacccattttcggagagtcctgttgatggtgtcatcgccgcacattgtagtgtt
agagtaatttctggccaatttctatcggatcgaaaaatcggaacatacgtggaagttgaa
atgtatggactgcctaccgatacgatacggaaagagcacaagacaaaagtgatcccggga
aacggactgaatccagtttacaacgaggacccatttgtatttcgaaaagttgtgcttccc
gagttggcggttcttcgatttgccgtgtacgatgaaaatggaaaacaattaggtcagcga
attctgccgttagatggcttgcaagccggatacagacacatctcattgcgatccgacacc
aatcagagcttcattttatcaccggtgctattcgttcaaatcgttatcaaaacttacgta
cctgatgagttgagcggtcttgtagacgctctcgctgatccacgtgcattcctttcggaa
caaaagaaacgacaggaggcgctggcacatatgggagtagatgatagtgatatcccagac
gtccctaatacaaagaatatggcgctgagaaatatgaaacaaccaccaaggcaaaacgga
tcgtcggctgatttattgtcgaataacacgcagcctggaagtgcgagaagtgaaacaacg
ccaacgttgggaacgagtgccatcagatcgcccaatgagcaaccggcacccgtggctgtt
gataagtttaaggttgacccaatcgaagtagacgatttgagacgagacaaagcgttcgcg
aaactgctcaaaaagttccagaaagatctggacgatcttcggaagaaacatcagaagcag
agggatagtattcagaagcaacagccggcacgccgccgtaattcgtctatagcgtggatc
caaaccaacgtggataagcttattaccaataaccggcgctccacaaagaaggaaaagggt
tcgagacgatcgctaacggcttcagtgtcttctggatgtggatccacttctggaagcatt
ccagtaggcgtttgtataccatcaggtccatgtggaagcggtagcggtgctccgtcgaca
ccaggaggatgtggttccgatggaaccgggtcaccagcaaccactggaagcccagttccg
cacgaccttattaacaacgatagggtccgctctcttgtgaacacccaaaccggcgagtgg
tcggcaatggttcggagacacgacgaagaggaatttgagctcaaaaaagggcagctcaaa
gagcaattcgatttgttaaagaaactgatgagtgaggcgcagaaaaatcaaatgcaggcg
ctgaaacttcgtctggaagccgagggaaaagatctgaagcagacgcagacgaagaagagt
atggaggatgtgaaggttattcagctggacaagggtatcaagaccaaggccgaacgcgat
cgacgcatcaaggagctcaacgagaagaacttgaagatgtttgttgaggagagaaagaga
ttagctatgaaagctcaaaaacacgaggaacagctcatcaaacggcacctggaccagctg
gaacaactagaaaaagacttccagaaagcattggaagccgaagttggcaactacaaagaa
gaacaactggctgctcaacccacttctgttgtttga

DBGET integrated database retrieval system