KEGG   Caenorhabditis briggsae: CBG06929Help
Entry
CBG06929          CDS       T01054                                 

Gene name
Cbr-pdhk-2
Definition
C. briggsae CBR-PDHK-2 protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 401 aa AA seqDB search
MRFSRKLLGPFVGSLAKKLDYYSQFQPSSLTIQQYLDFGRIGTAANSYTFLKNELLVRLA
NIMQEFTLLPPKLLQMPSSKMVSNWYAESFEDLLLFEASDASPEQVARFNDQLTVVLKRH
AHVVETMAEGLIELRESDGVDIASEKGIQYFLDRFYINRISIRMLQNQHLVVFGNVLPES
PRHVGCIDPACDVESVVYDAFENARFLCDRYYLTSPSMKLEMHNAVEKGKPISIVAVPSH
LYHMMFELFKNAMRATVEYHGVDDDLPDIKVYVVKGNEDLSIKICDRGGGVSRTILERLY
NYMYSTAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGHGTDACIYLKAVP
VEASEVLPIYSTSSRRNLTMGPQVADWSHHVPGQGNRPAQS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcgcggaagttgctgggtccattcgtaggctcgttggccaaaaaactcgat
tattacagtcaattccaaccgtcgtcgctcacaattcaacaatacttggactttggccga
ataggaaccgccgccaactcgtatacatttttgaagaatgagcttctcgttcgacttgcc
aatattatgcaggaattcaccctattgccaccaaagcttctgcaaatgcccagctcaaaa
atggtgtcaaactggtatgcggagagtttcgaggaccttcttctcttcgaagcatcagac
gcttcaccagagcaggttgctagattcaacgaccagctgactgttgtgctgaaaagacac
gctcacgtcgtcgagacaatggccgagggactgattgagttgagagagtcggatggggtg
gatattgccagtgagaaggggattcagtactttttggatcgattttatatcaatagaata
tccattcgtatgcttcagaatcaacatttggttgttttcggaaatgtccttccggagagc
ccacgccatgtcggctgcattgatccggcttgtgacgtggaaagtgtcgtctacgacgca
ttcgaaaatgctagattcctctgcgaccgttactacttgacaagtccatcgatgaaacta
gagatgcacaacgccgtcgagaagggaaaaccaatatctattgtcgcagttccgagtcat
ttgtatcacatgatgttcgaactgtttaagaatgccatgagagcaacggttgaatatcac
ggggtcgatgatgatttgccagatatcaaagtctatgttgtcaagggaaacgaggatttg
tcgattaagatctgtgatcgtggaggtggcgtgtcaagaacgattctggagcgtctctac
aactacatgtactcaacagctccaccgccaccaagggatggaacccaggcgccattggcc
ggatacggctacggactcccactctcccgtctctacgctcgatacttccttggtgaccta
ttcttggtttccatggaaggacacggaactgatgcttgtatttatttgaaggctgtgcca
gttgaagccagtgaggtcctgcctatctacagtacttcatcgcgtcgtaatctgacaatg
ggtccgcaggtcgccgattggtctcatcatgtacctggacagggaaatcgtcctgctcag
tcttga

DBGET integrated database retrieval system