KEGG   Caenorhabditis briggsae: CBG06929Help
Entry
CBG06929          CDS       T01054                                 

Gene name
Cbr-pdhk-2
Definition
C. briggsae CBR-PDHK-2 protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CBG06929 (Cbr-pdhk-2)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CBG06929 (Cbr-pdhk-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 401 aa AA seqDB search
MRFSRKLLGPFVGSLAKKLDYYSQFQPSSLTIQQYLDFGRIGTAANSYTFLKNELLVRLA
NIMQEFTLLPPKLLQMPSSKMVSNWYAESFEDLLLFEASDASPEQVARFNDQLTVVLKRH
AHVVETMAEGLIELRESDGVDIASEKGIQYFLDRFYINRISIRMLQNQHLVVFGNVLPES
PRHVGCIDPACDVESVVYDAFENARFLCDRYYLTSPSMKLEMHNAVEKGKPISIVAVPSH
LYHMMFELFKNAMRATVEYHGVDDDLPDIKVYVVKGNEDLSIKICDRGGGVSRTILERLY
NYMYSTAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGHGTDACIYLKAVP
VEASEVLPIYSTSSRRNLTMGPQVADWSHHVPGQGNRPAQS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcgcggaagttgctgggtccattcgtaggctcgttggccaaaaaactcgat
tattacagtcaattccaaccgtcgtcgctcacaattcaacaatacttggactttggccga
ataggaaccgccgccaactcgtatacatttttgaagaatgagcttctcgttcgacttgcc
aatattatgcaggaattcaccctattgccaccaaagcttctgcaaatgcccagctcaaaa
atggtgtcaaactggtatgcggagagtttcgaggaccttcttctcttcgaagcatcagac
gcttcaccagagcaggttgctagattcaacgaccagctgactgttgtgctgaaaagacac
gctcacgtcgtcgagacaatggccgagggactgattgagttgagagagtcggatggggtg
gatattgccagtgagaaggggattcagtactttttggatcgattttatatcaatagaata
tccattcgtatgcttcagaatcaacatttggttgttttcggaaatgtccttccggagagc
ccacgccatgtcggctgcattgatccggcttgtgacgtggaaagtgtcgtctacgacgca
ttcgaaaatgctagattcctctgcgaccgttactacttgacaagtccatcgatgaaacta
gagatgcacaacgccgtcgagaagggaaaaccaatatctattgtcgcagttccgagtcat
ttgtatcacatgatgttcgaactgtttaagaatgccatgagagcaacggttgaatatcac
ggggtcgatgatgatttgccagatatcaaagtctatgttgtcaagggaaacgaggatttg
tcgattaagatctgtgatcgtggaggtggcgtgtcaagaacgattctggagcgtctctac
aactacatgtactcaacagctccaccgccaccaagggatggaacccaggcgccattggcc
ggatacggctacggactcccactctcccgtctctacgctcgatacttccttggtgaccta
ttcttggtttccatggaaggacacggaactgatgcttgtatttatttgaaggctgtgcca
gttgaagccagtgaggtcctgcctatctacagtacttcatcgcgtcgtaatctgacaatg
ggtccgcaggtcgccgattggtctcatcatgtacctggacagggaaatcgtcctgctcag
tcttga

DBGET integrated database retrieval system