KEGG   Caenorhabditis briggsae: CBG06931Help
Entry
CBG06931          CDS       T01054                                 

Definition
Hypothetical protein CBG06931
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBG06931
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CBG06931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 1355 aa AA seqDB search
MNFLYSIFAPIIFLVTFLYNHVLLILFTVCIIGAVAFFVSYYLFAYSNTPSSASSSAATS
ARNSPNSELAYEAALITEEYVSEERKKKVPTILETDNEDDETRVDGLPRTGTPTKSLPLE
PPTSLPLNTMPTSISGSNLAGSRRMRKRDWAKKIYKSLVQDSPGRTPTDDSSDEDNGNLV
MGGASLPRRRSKQGSKSGRRHSTAFQMAKDLLRRGSRVYFRQNQENNKDTRLRPPQEFFE
PTDLPEIPQNLQPEIFYILHNLKMLELPSEWKLDPREIEVRSFQAGEYIVKPGESDDAIY
VAIDGELTVHIRHMEGKEYLVKRIPAGGSFFLLSMLDILMDFPSIFRTVALKAAEPCRVA
KFPITSFRESYHKNPEAWIRPIQIVITRLLHVTLTTLHQYMGLSSELMRRRRDDDRVRNG
SSTSKLHLTLSLKKKEKPFNINDSEEDQLTTARKWMAEAFGLVADDAISEQIGNKIHLES
YDAGHVIIEQGAEEEVLMMVLHGNLILAQSGSQYFAELERESLFDEENNEEDESAVIRVT
ARELVGGLQILTNEPSFYTIRAAVPTKVAIMKKKDFSTFLEAHPEIYLPVAHSVLRRLSP
FLRGVDFALDWVLVDSGHACYRAGDMADSLFVVLSGRLRSVEKKTVVEEFGRGDVLGMME
VLTKKPRATTVLAVRFSQLARVPEGLLNFIKMQYPQVGFRLVQLLGQYYSQTNRRAQFAA
PTVIRTNEMGATDPMSHIKNLHTIAVVPASPDVPLVPFTCELYHALSSNLRVLRLSSQKV
AACLDPSVLEKQADFRLMHWLNVQEDTYPLVIYECDFTPTNWTRRCLRQADAILVVAIGG
KHPEKQTLMKDLMSMNQDGVRTNKELILLWPESTKTPSGTIEWLKNSYFSGHHHIRAPKR
MLQWNRKVRKQSRIDLMTPSNVEHEVIEYYEKNVFWTTDRRSDFSRLARILTGNAIGLVL
GGGGARGAAHVGVLRALREEGIPVDIVGGTSIGSLIGGLYAESPDDQIVEQRAASWFSVM
SSLWRKLLDLTYAHSAMFTGAQFNYTIKDLFEERLIEDLWISYFCISTDISTSEMRVHRS
GPLWAYCRASMSLAGYLPPLCDPQDGHLLLDGGYVNNVPADVMRNLGARCVIACDVGSIE
ETNLYDYGDSLSGIWVLLKRLNPFGEPVRILNMEEIQSRLAYVSCVRQLEVVKKASYCRY
LRPPIEPFKTLDFPKFNEIMALGLKYGREAVHELITNDRAGILGDEKEARKFKRQQSRRE
KPDVSRAVSFTDLAAAMSKIPVMRPTLRHSMSLNPSATSGPVGRAGDHFLLDDDLFNESD
FYEEEESSQSETGNDSFSEDDDLVIGPPSNSSSSG
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcctctattcaatatttgcacccatcatttttcttgtcacattcctttataac
catgttctcctcattttattcaccgtttgcataattggagccgtcgcgttcttcgtctcc
tactatcttttcgcctactccaacacaccatcatcggcgtcgtcgagtgccgccacgtca
gctagaaactccccgaatagtgagttagcttatgaagctgccctaatcacagaagagtac
gtttcagaagaacgtaaaaagaaagtgccgacgattctggagacagacaacgaggatgat
gagacacgtgtcgatggacttccgagaacgggtacacccactaaatcacttccactggaa
ccgccgacttcacttccactcaacactatgcctacttcaatcagcggatccaatttggcg
ggttcacgacggatgagaaaacgagattgggccaagaagatttataagagtttagtgcaa
gattctcctggccgaacacccacggacgattcatccgacgaagacaacggaaatcttgtg
atgggtggcgcatcactccctcgacgtcgttcgaaacaaggctccaaatctggaagacgt
cattctacagcatttcagatggccaaggacctcctccgtcgtggaagtcgtgtgtacttc
cgacagaatcaggagaacaacaaagacacccgtcttcgtcctccacaagaattctttgaa
cctacagatcttccagagatcccacagaatcttcaacccgagatattctatattcttcat
aatttgaagatgctcgagttgccatcggaatggaagttggatccacgagagattgaggtt
cggtctttccaagctggagagtacattgtgaagcctggagaatcagatgacgcgatttac
gttgcgattgatggagaattgactgttcacattcggcacatggaaggcaaagagtatctg
gttaaacgaattccagccggaggaagtttctttctcctctcaatgctcgatattctcatg
gatttcccgtccatcttccgtacagtagccctaaaagccgccgaaccatgccgcgtcgcc
aaattcccgatcacttcgttccgcgagtcgtaccacaagaatccagaagcatggatccgt
ccgattcaaattgtcattactcgattgcttcatgtcacactaaccacactgcatcagtat
atgggactgagcagcgagttgatgagaagaagaagagacgacgacagggtgcgcaatggc
agcagcacatcgaaactccatttgacgttgtcgctgaaaaagaaagagaaaccattcaat
atcaatgatagcgaagaagatcagctcacaactgccagaaaatggatggccgaagcgttt
ggactcgttgcagacgacgctatctcagaacaaatcggcaacaagattcatctggagagc
tatgacgccggtcacgtcatcattgagcaaggagcagaggaagaggttctgatgatggtg
ctccatggaaatttgattcttgctcagtccggttcgcagtactttgcagagctggagagg
gaatctctgttcgatgaggagaataatgaggaagacgagagtgcagtgattcgagtcaca
gctcgggaactcgtcggtggccttcagattctgacgaatgaaccatcgttctatacaatt
cgtgcagcggtgccaactaaagtggccatcatgaagaagaaggatttctcgacgttctta
gaagcacatcctgagatctaccttccagtagctcactctgttctacgtcgactctctcca
ttccttcgtggagtcgattttgcattggattgggtcctcgtcgattcgggacacgcttgc
tatcgtgctggagacatggctgactccctattcgtcgttctcagtggacgacttcgttcc
gttgagaagaagacagttgtagaagaattcggtcgtggagatgtgctcggaatgatggag
gtgctcaccaaaaagccacgtgcaactacagtacttgctgttcgtttctctcaacttgct
cgagtgccagaaggacttttgaactttatcaaaatgcaatacccacaagtcggattccgt
ttggttcagcttcttggtcagtactacagtcaaacgaatcgccgggctcagtttgctgct
ccaactgtcataagaaccaatgaaatgggcgctaccgatccaatgagtcacatcaagaat
cttcataccatcgctgtggtcccagcatctccagatgttccattggtgcctttcacatgt
gaactctatcatgctctatcctccaatcttcgtgttcttcgtctcagcagtcagaaagtg
gctgcctgtttagatccgagtgttttggagaaacaagctgacttccgtctgatgcattgg
ctgaacgttcaggaagacacgtatccactggtgatctatgaatgcgacttcactccgacc
aattggacgagacggtgtcttcgacaggctgatgcgattttagtcgttgccattggtgga
aaacatccggagaaacagacactgatgaaggacttgatgagtatgaatcaggatggagtt
cgtactaacaaggaactgattctactgtggccagagagcacgaagaccccatctggaacg
attgaatggctcaagaacagctatttctctggtcatcaccatatccgtgcaccgaagaga
atgctccagtggaatagaaaagttcgaaaacagagccgaattgatctgatgacaccgtcc
aacgtggagcatgaagttatcgagtactacgagaagaatgtattctggacaactgataga
agatctgacttctcgagacttgcacgaattctgactggaaatgccatcggattggttctt
ggtggtggtggagctagaggagcagcacatgttggagttctccgagcacttagagaggag
ggaatcccagtggatatcgttggaggaacatcaatcggatcgttgatcggaggactttat
gctgaatctccagatgatcaaattgtggaacaacgggctgcgtcttggttcagtgtgatg
tcttcgttgtggagaaaacttcttgatttaacttatgctcatagtgctatgttcaccggt
gctcaattcaactacacaatcaaggacctgttcgaagaacgtcttatcgaggatctctgg
atttcttacttctgtatctccactgacatcagcacttcggaaatgcgagttcatcgatct
ggaccactctgggcttactgtcgtgcgtctatgtcattggctggataccttccaccactc
tgtgatccacaagatggccacctccttctggatggtggatatgtcaacaacgtgccagct
gatgtgatgagaaatttgggagcccgttgtgtgatcgcttgtgacgttggatcgatagaa
gagaccaatttgtacgactatggagactcgttgagcggaatctgggtgcttctgaaacgt
ctgaatccgttcggagagccagtacgaattctgaatatggaagagatccagagccgactc
gcctacgtatcctgtgttcgacagttggaggttgtcaagaaagcgtcgtactgtagatat
ctgagacctccaatagagccattcaaaacactggatttcccgaagttcaatgagattatg
gccctcggactgaaatatggacgtgaagcggtgcacgaactgatcacaaacgatcgtgct
ggtattcttggagacgagaaggaggccagaaagttcaaacgacaacaaagtcgtcgtgag
aagccagatgtgtctcgtgcggtttcattcaccgatctcgctgctgcaatgtccaaaatt
ccggtgatgcgaccgacgttgcgacactcgatgagtctgaatccgtctgcaacttctggt
ccggtcggaagagctggtgatcatttcctgttggatgatgatttgttcaatgaaagcgac
ttctacgaggaagaggaatcatcgcaatccgaaactggcaacgactcgttctctgaagac
gacgatcttgtcattggcccaccgagcaattcatcgtcatctggt

DBGET integrated database retrieval system