KEGG   Caenorhabditis briggsae: CBG07253Help
Entry
CBG07253          CDS       T01054                                 

Gene name
Cbr-tag-172
Definition
C. briggsae CBR-TAG-172 protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 1023 aa AA seqDB search
MLTELYPMLCFHSLGFLFISMATSKVAVPTTTVDQSTSFAFPSSPSVSPYCLTACSSPNP
QSSSREPSASTNNHHLLSPLVSRRHYISHRLPQRAVLSNAPPIQSAAIVFKTSAVQSQAQ
PQPPPILVVGPPQEMPVFHQKVASSGGAGSIANPNSLALRRLPLVVIPRKRKYKNYVSRR
RNTQLLASLRRCVSDPHLYKSYNHWKGLSSPMTPIKSGAPTPSLAPTSKTSTPLTVPPAV
PAHKKLTPNPSPTQNPVKLPSPHAVSEKPEKIERIENAEKPLAEKSKAAVAPTTVPARAP
VTKPAAPKTPVATVAPLAEQEGSSSFNQFPAPSPISKQVSGKLTELKSKNGPPTEKTVLR
IPSAASTRAKLASAETQPQPTPAKPSPFAPAIAPLRDGAPAQPAPVQNVAAPPRPPVAKQ
NSLQKPPEPKRSIGAPPKPIVPNEAVHKIDGIEFLPKEPEDGQLPTTSTGGPKALRRAYG
SKSGTTICAIGSPNVPSTSHAAPPPADDEKRLIEKKLSLRKKKMAGEGVPGGSLLTGSKS
GVEIGLSLNNNNNVKEQTDEQRAKKTVNAVSAAFSTQGGSGAGQGAPPEEPTTTATIREP
PPPGAQKPKSAAVQNLITQLQLPASVSAKVDKIIASGDKARKPSRTGLQTQQNRSKIIEQ
NPLATDKLRDDKDGHLVYSKGDFILNRFVIHETLGEGTFGKVVRVIDTVTDNFMALKIIK
NVNKYREAARLEIKVLQRLSERDKEKQNWVIHMGGHFEYQGHMCLMFDLLGPSIFDFLKN
NHYRPYPINQTMHIAWQVCKAVKFLHENKLTHTDLKPENILFVSGDYTTQVMDKKPTKVL
KETQIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWNQPCDVWSVGCILYELYTGC
TLFQTHENREHLAMMERVLGDIPPRMAKKTKTKFFVNGRLDWAQSSPDAAYVRDNCKPLR
RSMTCTEPEHVELFEIIEHMLAYEPMGRMKLSEAIEHRWFRRLPDELKHSTVLTPPTKAN
FPM
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgagctctatccaatgctctgtttccactccctcggattcctgttcatttct
atggccacctccaaagtggccgtgccaacgacgacggtggaccaatccacgtcatttgca
ttcccttcatctccatcggtctcaccgtactgtctgaccgcgtgctcatcaccaaaccca
caatcatcgtcgcgtgagccttcagcctcgacgaacaaccatcatcttttatcacctcta
gtctcacgtcgtcactacatctctcatcgattacctcaacgagctgtactttcgaacgcg
ccaccaatccagtcagctgctattgtctttaagacatcggcggtgcaaagtcaagcgcaa
ccccaaccaccaccgatattagtcgtaggtcctccccaagaaatgccagtatttcatcaa
aaagtggcaagcagcggcggcgctggttccattgccaatcccaattctttggcactccgt
cgtctaccacttgttgttattccacgaaaacgaaaatacaagaattacgtttctcgtcgc
cggaatactcaactacttgccagtttacgaagatgtgtctctgacccccacctctacaaa
agctacaaccactggaaaggtctttccagcccgatgactcctataaaatctggagctcct
acaccatctctcgcacccacttctaaaacttctactcctcttaccgtaccaccagcggta
cccgctcataaaaagttgacaccgaatccgtcgcctactcaaaatcctgtcaaacttcct
tctccacatgcagtttccgagaagccagaaaaaatagagagaattgagaacgctgaaaaa
ccactggcggaaaaatctaaagctgcagttgctccaactacagtacccgcgagagctcca
gtaacaaagcccgctgctcctaaaactccagtagctactgttgctcctttggctgaacag
gaaggttcatcaagcttcaaccaatttcctgctccatctccaatttcgaagcaagtctct
ggaaaactaacagagctgaagagcaagaatggtccaccaactgagaagaccgtgctaagg
attccatccgctgcgtctactagggcgaaattagcttctgctgaaactcaaccccagcca
acacctgctaaaccttctccatttgctccagcgattgctcctctgagggacggtgccccc
gctcaaccagcgcctgttcaaaatgttgcagctccaccaaggccacctgtcgcaaagcag
aactctcttcaaaagcctcccgagccaaaacgatcaattggcgctcccccaaagccaata
gtaccaaatgaagctgtacataaaattgacggcattgagtttcttcccaaagaaccggaa
gatggtcaacttcccactacttctacgggtggtccgaaggctctccgacgagcttatgga
tctaaatcgggtaccacgatatgtgcaattggcagtccaaatgtgccatcgacaagtcat
gcggctccaccaccagcggatgacgagaagaggttgatagaaaaaaagttgtctcttcga
aaaaagaaaatggctggagagggagtaccaggaggatcactactaactggatcgaaatct
ggtgtagaaattgggttgagcttgaataacaacaataatgtcaaagagcaaaccgatgag
caacgtgctaagaaaactgtgaatgccgtatctgctgcgttttccactcaaggaggatct
ggagcaggtcaaggtgcacctccagaagagccgactactactgcaaccattcgagaacca
ccaccacctggcgctcaaaaaccaaaatctgcagcggttcaaaatttgataacacagctc
caactaccagcttctgtatctgcaaaagttgataaaatcattgctagtggtgataaggca
cggaaaccgtctagaactggtttacagactcaacaaaaccgaagcaagattatcgagcag
aatccattggccacggacaagttgagagatgataaggatggtcatttggtctactccaag
ggagatttcattttgaacagatttgtcatccacgaaacacttggagaaggaaccttcgga
aaagttgttcgagtcatcgatacggtcactgacaacttcatggcgctgaaaattatcaag
aacgttaacaagtaccgtgaagctgccagacttgaaattaaggtgctccaaaggttgtcg
gagagagataaggagaaacaaaactgggtcattcacatgggaggccacttcgaataccaa
ggacacatgtgcttgatgtttgatttgttgggaccatcgattttcgacttcttgaagaac
aatcactatcgtccctatccaatcaaccaaacgatgcacatcgcgtggcaagtttgtaag
gcagtcaagtttttgcacgagaacaagctcacccacaccgacttgaagcctgagaacatc
ctgttcgtatctggtgactacactacccaagtaatggacaagaagccgaccaaagtcctg
aaagaaacacaaattcgattgatcgattttggatcggccactttcgatcatgagcatcac
tcaacgattgtgtctacacgccattacagagctccggaagttattcttgaactcggatgg
aatcaaccgtgcgacgtctggtctgttggatgtattctctacgagctgtacactgggtgc
accctcttccagactcacgagaaccgtgaacacttggcgatgatggagcgagtgcttgga
gatattccaccaagaatggctaagaagacaaaaaccaagttctttgtcaatggccgcttg
gactgggcgcaatcttccccggatgctgcctacgttcgtgacaactgcaagccactcagg
cgctccatgacctgcactgagccagagcacgttgagttgttcgaaattatcgagcacatg
cttgcttacgaaccaatgggacgaatgaaattgtcggaagcaatcgaacaccgttggttc
cgacgtcttccagacgaattgaagcattctactgtgctgacacctccgaccaaggcaaac
ttcccaatgtaa

DBGET integrated database retrieval system