KEGG   Caenorhabditis briggsae: CBG07597Help
Entry
CBG07597          CDS       T01054                                 

Gene name
Cbr-mbk-1
Definition
C. briggsae CBR-MBK-1 protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CBG07597 (Cbr-mbk-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CBG07597 (Cbr-mbk-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 884 aa AA seqDB search
MNSGEKQDNLQAWGQQPSSSYSNTQQQHGQITGQIPLTITNQVEAHDNDFHMQDASNDEL
EKSKKIAEQPTEHPQQHHQQQPAVPRFPPQSRQPQAILRFPQPPITSINKANNSNSQNFF
PQQEVLQSRPKKHRVSMTNAEAANTPGMPPEKLPAKKLSADSQRPLFRDSNVFQRSAGQF
TNDNGPSSSSAIVGAPFDANSSSKPVHIQQFRNPNDAPVTKLTSDLIKTYKAINESFYLR
KNVRRSTVGRHTSLDSSGKPKTGKEASSSDANLIETFSIHNAVPNTSSSGNQPHYDSHVN
APPLLDTNAPPTSTMVVPMRTETESQQQMRQKSSRGGPYNNGYDDQNYDYILKNGEIFDK
RYVILSDTPVGKGSFGQVTKAYDTVTKEEVAIKIIKNKKTFFDQAQIEIHLLELTNAHDK
DNKYNIVTLKGHFVHRAHLCLVFELLSYNLYDLLKNTNFRGVSLNLARKFAQQLGKTLLF
LSSPELSIIHCDLKPENVLLVNAKRSQIRVIDFGSSCQTGHRIYQYIQSRFYRSPEVLLG
IAYDTKIDMWSLGCILVEMHTGEPLFAGSSEVDQMMKIVEVLGMPPKEMLDIGPKTHKYF
DKTEDGIYYCKKTRDGYRHTYKAPGARKLHEILGVTSGGPGGRRLGEPGHSVEDYSKFKD
LIKRMLNFDPKQRILRTTLFPVSHTAYNQNLYHQQQIDQVPAVGSVYIEDNGMYRPVPTS
SHPISVTSSFDDGDVIEIDPNRRRYSQQNYHNPNYQYSQQPQSSSQQQQQQYQQSQRAQL
EKQQQLQQQQQQQQQQRQHLSHQPSQSVQQHSSSSSRSRPRQQDQAEWRTQLELEEAFKQ
RKAEEATAPRSLQYNPQQGSMSHGNVNAGSSRDMEKHDYPNNKL
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcggagagaagcaagataatcttcaagcctggggccaacaaccatcgtcaagt
tattcaaatacccaacaacagcacggacaaatcactggtcaaattcccctcacaattact
aaccaagtcgaagcacacgacaacgattttcacatgcaagatgcgtcgaatgacgagctt
gaaaagtcaaaaaagatagcggagcaaccgacggagcatccacagcaacatcaccagcaa
caaccagcagtgccacgtttcccgccacaaagtcggcagccacaagccattctgagattc
ccacaacccccaatcacctcgattaacaaggccaacaattcgaattcgcagaatttcttc
ccacagcaagaggttctacaaagtcgcccgaagaagcatcgagtctcaatgacgaatgca
gaagcagctaatactcccggaatgcctccggaaaagctaccagccaagaagctgtctgcg
gatagtcaacgaccactgttccgagattccaatgtattccaaagaagcgcaggtcaattc
acaaatgataatggcccatcaagctcgtctgcaatagtgggagccccatttgatgcaaat
tcttcatcaaaaccagtgcacattcaacaatttcgcaatcccaatgacgcacccgtcaca
aaactgaccagtgatctcatcaaaacctacaaggctattaacgaatctttctaccttcgc
aaaaacgttcgacgcagcacggtcggccgccatacaagcctcgattccagtggcaaacca
aaaaccggtaaagaagcttcctcctctgacgcaaacctgattgaaacgttctcaattcac
aacgcggtaccaaacacgagttcgagtggcaatcagccacattatgattctcatgtgaat
gctcccccacttcttgacaccaacgctccaccaacgtctacaatggtcgttccaatgcga
acggaaaccgaatcgcagcagcaaatgcgtcagaagagtagccgtggcggaccgtacaac
aacgggtacgacgatcaaaactatgactacattctcaaaaacggggaaatctttgacaaa
cgttatgtcattttgagtgacactccagttggaaaaggatcgttcgggcaagtcaccaaa
gcttacgatactgtaaccaaagaagaagtggctattaagattattaagaataagaagacg
ttcttcgaccaagcacagattgaaatccaccttttagagctgaccaatgctcatgataaa
gataataagtataatattgttaccctcaaaggccactttgtacatcgtgctcacttgtgc
ttggtattcgagctgctctcttacaatctctatgatcttttaaaaaataccaacttccgt
ggagtctccctcaatttggctcgcaaatttgctcaacaactcggtaaaaccctcctgttc
ctttcctcacccgaactctcaatcattcactgcgacttgaaacctgaaaatgtgctgctc
gttaacgccaagcgatctcaaattcgtgtcattgattttggatcatcctgtcaaacaggt
cataggatttatcaatacattcagtcgcgattctatcgttcgccagaagttctgcttggt
atcgcgtatgacacgaaaattgatatgtggtcgcttggatgcattctcgttgaaatgcac
accggagagccactctttgctgggtcatcggaggtagatcaaatgatgaagattgttgaa
gttcttggaatgccaccaaaggaaatgttggatatcgggcctaaaactcacaagtatttc
gacaaaaccgaggatggaatctactattgtaagaagactcgagacggatatcgacacacc
tacaaagctccgggagcaagaaaattgcacgagattttgggtgtgacttctggaggacca
ggaggacgacgtctcggagagccaggacattctgttgaggactacagcaagttcaaggat
ctgatcaagagaatgttgaactttgacccgaaacaacgcattctccgtactacgttgttc
cctgtctctcacaccgcgtacaatcagaacctttaccatcagcagcaaatagatcaagtc
ccagctgttggatcggtgtacattgaggataacgggatgtatcgcccggttcccacttcc
tcccatcccatttccgtgacctcctcgttcgacgatggggatgtgattgagatcgatccc
aatagacgccgctactcgcaacagaactaccacaatcccaattatcagtactctcagcag
ccgcagtcgtcttctcaacaacaacaacagcagtatcagcagtctcaaagagcacaattg
gagaaacaacagcagctccagcaacagcagcaacagcagcaacaacaacgacagcacctc
tcgcaccaaccatctcaatctgtccagcaacattccagctcttcatctcgttcccgtccc
agacaacaggatcaggctgaatggagaacacagctagagctcgaagaagctttcaagcag
cgcaaggctgaggaagccacggctccaagatccctgcaatacaacccacaacagggaagt
atgagtcatgggaatgtgaatgccggcagcagtcgagacatggagaagcacgactaccca
aacaacaaactttga

  All links  
No link information was found.   
DBGET integrated database retrieval system