KEGG   Caenorhabditis briggsae: CBG07610Help
Entry
CBG07610          CDS       T01054                                 

Gene name
Cbr-hex-5
Definition
C. briggsae CBR-HEX-5 protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cbr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 452 aa AA seqDB search
MMSGLGATGVLMEWEDMFPYQGNLNRIVNKNAYTEEEVISILEHAQQLELEVIPLVQTLA
HMEWILKNEEFSHLREDERYPMVACIGDPSSLELILDSVNQLMQVHSKFNTRYIHIGADE
AFQVGICEADRLILPVKYENDTLRMIFNHLKKVSINVTEEFPATKVLMWYDELKSAPLEL
IKEYSLDELVIPVVWKYTANLDNDLPPEMWKNMSYSFKEVWGGRADGASRYWNRLKPYIL
NNKEWYLQNEKYKLHFTTFDSIIITGWQRYDHFASLCELWPTSMVSLALNLIVLTKFHID
TASAEQVINALNCPPSTTLDQLVAGTDKCRYPGYRARDAIRDYFQLKTFFENSTWVHNRE
NGWLQSSHMRLSASNPYYIDAIGKAYERTLKKMDTITNNMRTAFTEIFYPDVIEEFETDY
ITPFYEELQKRKDAVANIDTKRSYGPRPWFRL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtggtttaggagcaactggggtgctaatggagtgggaggatatgttcccctac
caaggaaatctaaatcggatcgtcaacaaaaacgcctacaccgaagaggaagtgataagt
attctggaacatgctcaacagctggaacttgaagtcatcccacttgtgcaaactttggca
cacatggaatggattttgaaaaatgaagaattttctcatttacgggaagatgaacggtac
ccaatggtagcgtgtattggagatccatctagtttggaattgattcttgattcagttaat
cagttaatgcaagttcattcgaaattcaacacacgatatattcatattggtgctgatgaa
gcattccaagtcggaatatgtgaagcggatcgtctaatcctccctgtgaaatatgaaaac
gacacgcttcgaatgattttcaaccatttgaaaaaggtgtcgatcaatgtcaccgaagaa
ttcccggcgacgaaggttttaatgtggtacgacgaactgaaaagtgcgccgttagaacta
atcaaagaatatagtcttgatgaactggtgataccggtcgtgtggaaatacactgcgaat
ttggataatgacctgccgcccgagatgtggaaaaatatgtcatactcgttcaaagaagtt
tggggtgggagagctgacggagctagtcgctactggaatcgcctcaaaccatacattttg
aacaataaggaatggtatcttcagaacgaaaaatacaagttacacttcacaacctttgat
tctatcattatcactggttggcaaagatacgatcacttcgcatcgctatgtgaactttgg
ccaacttcaatggtatcattggcgctgaacctgatagttctaaccaagtttcatatagac
acagcgtctgcggaacaggtcatcaacgccctcaattgtccgccgtctactactcttgac
caattggtagctggaactgacaagtgtcggtatccaggctatcgcgcacgtgatgcaata
agggactattttcagttgaagacattctttgaaaattccacttgggtccataatagagag
aatggatggcttcaatcatcccatatgcggttatcagctagcaatccgtactatattgat
gcaatcggaaaagcttatgagcgaactctaaagaaaatggacacaatcactaacaatatg
aggacagccttcactgaaatattctacccggatgtgatagaggaattcgaaactgattac
atcacaccgttctatgaggaactgcaaaaaagaaaagacgcggtcgccaacattgacacc
aagcggtcatatggacctcgtccgtggttccggctgtga

DBGET integrated database retrieval system